BLASTX nr result
ID: Glycyrrhiza23_contig00019684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019684 (538 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001240852.1| phytosulfokines 3-like precursor [Glycine ma... 80 1e-13 ref|XP_003550298.1| PREDICTED: putative phytosulfokines 4-like [... 75 6e-12 tpg|DAA00282.1| TPA_exp: putative phytosulfokine peptide precurs... 75 8e-12 ref|XP_003550299.1| PREDICTED: phytosulfokines-like [Glycine max] 72 7e-11 ref|XP_003589040.1| Phytosulfokine [Medicago truncatula] gi|3554... 70 3e-10 >ref|NP_001240852.1| phytosulfokines 3-like precursor [Glycine max] gi|23466385|tpg|DAA00283.1| TPA_exp: putative phytosulfokine peptide precursor [Glycine max] Length = 79 Score = 80.5 bits (197), Expect = 1e-13 Identities = 43/63 (68%), Positives = 47/63 (74%) Frame = +3 Query: 126 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 305 +ASRP+ +SS HEDV A K E D+ESCE EG EECL RRTLAAHVDYIYTQKH Sbjct: 20 HASRPNPSLNVVSSSHEDVAATK--EEIDEESCE--EGTEECLIRRTLAAHVDYIYTQKH 75 Query: 306 KPK 314 KPK Sbjct: 76 KPK 78 >ref|XP_003550298.1| PREDICTED: putative phytosulfokines 4-like [Glycine max] Length = 82 Score = 75.1 bits (183), Expect = 6e-12 Identities = 40/61 (65%), Positives = 44/61 (72%) Frame = +3 Query: 126 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 305 YASRP+ +SSLH DV A K E+D ESCE EG EECL RRTLAAH+DYIYTQK Sbjct: 20 YASRPNPSLISVSSLHGDVAATKAEEIDG-ESCE--EGTEECLARRTLAAHLDYIYTQKD 76 Query: 306 K 308 K Sbjct: 77 K 77 >tpg|DAA00282.1| TPA_exp: putative phytosulfokine peptide precursor [Glycine max] Length = 79 Score = 74.7 bits (182), Expect = 8e-12 Identities = 42/63 (66%), Positives = 46/63 (73%) Frame = +3 Query: 126 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 305 +ASR + K SSL EDV A K E ++ESCE EG EECL RRTLAAHVDYIYTQKH Sbjct: 20 HASRLNPSLKVFSSLREDVAATK--EEINEESCE--EGTEECLIRRTLAAHVDYIYTQKH 75 Query: 306 KPK 314 KPK Sbjct: 76 KPK 78 >ref|XP_003550299.1| PREDICTED: phytosulfokines-like [Glycine max] Length = 60 Score = 71.6 bits (174), Expect = 7e-11 Identities = 42/59 (71%), Positives = 44/59 (74%) Frame = +3 Query: 138 PSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKHKPK 314 PSL K SSL EDV A K E ++ESCE EG EECL RRTLAAHVDYIYTQKHKPK Sbjct: 7 PSL--KVFSSLREDVAATK--EEINEESCE--EGTEECLIRRTLAAHVDYIYTQKHKPK 59 >ref|XP_003589040.1| Phytosulfokine [Medicago truncatula] gi|355478088|gb|AES59291.1| Phytosulfokine [Medicago truncatula] Length = 55 Score = 69.7 bits (169), Expect = 3e-10 Identities = 33/48 (68%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = +3 Query: 177 DVEANKLSELD-DDESCEGAEGVEECLTRRTLAAHVDYIYTQKHKPKN 317 D+ ++K S +D +DE+CEG EG +ECLTRRTLAAH+DYIYTQ HKPKN Sbjct: 9 DIVSSKASSVDLEDENCEGVEGEQECLTRRTLAAHLDYIYTQ-HKPKN 55