BLASTX nr result
ID: Glycyrrhiza23_contig00019623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019623 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355... 96 2e-18 ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing pro... 95 7e-18 ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing pro... 91 1e-16 ref|XP_004172925.1| PREDICTED: C2 and GRAM domain-containing pro... 89 5e-16 ref|XP_004139509.1| PREDICTED: C2 and GRAM domain-containing pro... 89 5e-16 >ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355483380|gb|AES64583.1| Synaptotagmin-1 [Medicago truncatula] Length = 1042 Score = 96.3 bits (238), Expect = 2e-18 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 263 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGRQRFKTKVIKKSLNPKW 406 MKLVVRVIEA NLPPTDPNGLSDPYVRLQLG+QRF+TKVIKKSLNPKW Sbjct: 1 MKLVVRVIEAMNLPPTDPNGLSDPYVRLQLGKQRFRTKVIKKSLNPKW 48 >ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 1018 Score = 94.7 bits (234), Expect = 7e-18 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 263 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGRQRFKTKVIKKSLNPKW 406 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLG+ RF+TKVIKK LNPKW Sbjct: 1 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGKHRFRTKVIKKCLNPKW 48 >ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 1018 Score = 90.9 bits (224), Expect = 1e-16 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 263 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGRQRFKTKVIKKSLNPKW 406 MKLVVRVIEAKNLPPTD NGLSDPYVRLQLG+ RF+TKVIKK LNPKW Sbjct: 1 MKLVVRVIEAKNLPPTDLNGLSDPYVRLQLGKNRFRTKVIKKCLNPKW 48 >ref|XP_004172925.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like, partial [Cucumis sativus] Length = 870 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = +2 Query: 245 CPF*KKMKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGRQRFKTKVIKKSLNPKW 406 C K MKL V VIEA+NLPPTD NGLSDPYVRLQLG+QRF+TKV+KK+LNP W Sbjct: 2 CSGSKNMKLTVHVIEARNLPPTDLNGLSDPYVRLQLGKQRFRTKVVKKTLNPTW 55 >ref|XP_004139509.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Cucumis sativus] Length = 1034 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = +2 Query: 245 CPF*KKMKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGRQRFKTKVIKKSLNPKW 406 C K MKL V VIEA+NLPPTD NGLSDPYVRLQLG+QRF+TKV+KK+LNP W Sbjct: 2 CSGSKNMKLTVHVIEARNLPPTDLNGLSDPYVRLQLGKQRFRTKVVKKTLNPTW 55