BLASTX nr result
ID: Glycyrrhiza23_contig00019609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019609 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 166 1e-39 ref|XP_002446122.1| hypothetical protein SORBIDRAFT_06g002025 [S... 58 9e-07 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 166 bits (421), Expect = 1e-39 Identities = 83/92 (90%), Positives = 86/92 (93%) Frame = +2 Query: 2 RPNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSQAFSSTSPLQSSIKLAFPRRYEMGVF 181 RPNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPS+AFSST PLQSSIKLAF RR EMGVF Sbjct: 17 RPNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSSTFPLQSSIKLAFSRRSEMGVF 76 Query: 182 PSPIVCIGLASSRTKEAFWRARACRKADHYIS 277 PSPIVCIGLASSR+K + RARACRKADHYIS Sbjct: 77 PSPIVCIGLASSRSK-LYLRARACRKADHYIS 107 >ref|XP_002446122.1| hypothetical protein SORBIDRAFT_06g002025 [Sorghum bicolor] gi|241937305|gb|EES10450.1| hypothetical protein SORBIDRAFT_06g002025 [Sorghum bicolor] Length = 132 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 2 RPNHHTTRIDANPPRYRTCDSHRIRLAQR 88 RPNHHTT IDANPP YRTCDSHRIRL R Sbjct: 20 RPNHHTTCIDANPPPYRTCDSHRIRLTVR 48