BLASTX nr result
ID: Glycyrrhiza23_contig00019394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019394 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538102.1| PREDICTED: bifunctional nitrilase/nitrile hy... 105 3e-21 ref|NP_001241587.1| uncharacterized protein LOC100810230 [Glycin... 103 1e-20 gb|AAT36331.1| nitrilase 4A [Lupinus angustifolius] gi|79082433|... 103 1e-20 gb|ABA28312.1| nitrilase 4B [Lupinus angustifolius] gi|79082461|... 101 7e-20 ref|XP_004173224.1| PREDICTED: bifunctional nitrilase/nitrile hy... 100 1e-19 >ref|XP_003538102.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A-like [Glycine max] Length = 350 Score = 105 bits (263), Expect = 3e-21 Identities = 52/57 (91%), Positives = 53/57 (92%) Frame = +1 Query: 1 ALISADLDLGEIARAKFDFDVIGHYSRPEVLSLIVKDQPATPVAFTSTSTKIEDKTK 171 ALISADLDLGEIARAKFDFDV+GHYSRPEVLSLIVKD P PV FTSTSTKIEDKTK Sbjct: 294 ALISADLDLGEIARAKFDFDVVGHYSRPEVLSLIVKDHPTNPVTFTSTSTKIEDKTK 350 >ref|NP_001241587.1| uncharacterized protein LOC100810230 [Glycine max] gi|255636059|gb|ACU18374.1| unknown [Glycine max] Length = 350 Score = 103 bits (258), Expect = 1e-20 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = +1 Query: 1 ALISADLDLGEIARAKFDFDVIGHYSRPEVLSLIVKDQPATPVAFTSTSTKIEDKTK 171 ALISADLDLGEIARAKFDFDV+GHYSRPEVLSL VKD P PV FTSTSTKIEDKTK Sbjct: 294 ALISADLDLGEIARAKFDFDVVGHYSRPEVLSLTVKDHPTNPVTFTSTSTKIEDKTK 350 >gb|AAT36331.1| nitrilase 4A [Lupinus angustifolius] gi|79082433|gb|ABB51979.1| nitrilase 4A [Lupinus angustifolius] Length = 349 Score = 103 bits (257), Expect = 1e-20 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +1 Query: 1 ALISADLDLGEIARAKFDFDVIGHYSRPEVLSLIVKDQPATPVAFTSTSTKIEDKTK 171 ALISADLDLGEIARAKFDFDV+GHYSRPEVLSL+VKD P PV FTS STKIEDKTK Sbjct: 293 ALISADLDLGEIARAKFDFDVVGHYSRPEVLSLVVKDHPTNPVTFTSASTKIEDKTK 349 >gb|ABA28312.1| nitrilase 4B [Lupinus angustifolius] gi|79082461|gb|ABB51980.1| nitrilase 4B [Lupinus angustifolius] Length = 350 Score = 101 bits (251), Expect = 7e-20 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +1 Query: 1 ALISADLDLGEIARAKFDFDVIGHYSRPEVLSLIVKDQPATPVAFTSTSTKIEDKTK 171 ALISADLDLGEIARAKFDFDV+GHYSR EVLSLIVKD P PV FTSTSTKIED+TK Sbjct: 294 ALISADLDLGEIARAKFDFDVVGHYSRSEVLSLIVKDHPTNPVTFTSTSTKIEDQTK 350 >ref|XP_004173224.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A-like, partial [Cucumis sativus] Length = 302 Score = 100 bits (249), Expect = 1e-19 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = +1 Query: 1 ALISADLDLGEIARAKFDFDVIGHYSRPEVLSLIVKDQPATPVAFTSTSTKIEDKTK 171 ALISADLDLGEIARAKFDFDV+GHY+RPEVLSL+V+D P TPV FTSTSTK+ED K Sbjct: 245 ALISADLDLGEIARAKFDFDVVGHYARPEVLSLVVRDHPTTPVTFTSTSTKVEDSCK 301