BLASTX nr result
ID: Glycyrrhiza23_contig00019383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019383 (461 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594657.1| Serologically defined colon cancer antigen-l... 128 4e-28 ref|XP_003547349.1| PREDICTED: nuclear export mediator factor NE... 127 9e-28 ref|XP_002519281.1| conserved hypothetical protein [Ricinus comm... 125 4e-27 ref|XP_003533123.1| PREDICTED: nuclear export mediator factor Ne... 125 5e-27 ref|XP_004157045.1| PREDICTED: nuclear export mediator factor NE... 121 7e-26 >ref|XP_003594657.1| Serologically defined colon cancer antigen-like protein [Medicago truncatula] gi|355483705|gb|AES64908.1| Serologically defined colon cancer antigen-like protein [Medicago truncatula] Length = 1146 Score = 128 bits (322), Expect = 4e-28 Identities = 65/82 (79%), Positives = 65/82 (79%) Frame = +3 Query: 216 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLTPKTYVFKLMNXXXXXXXXXXXXXXXXM 395 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLTPKTYVFKLMN M Sbjct: 1 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLTPKTYVFKLMNSSGMTESGESEKVLLLM 60 Query: 396 ESGVRLHTTVYMRDKSNTPSGF 461 ESG RLHTTVYMRDKSNTPSGF Sbjct: 61 ESGARLHTTVYMRDKSNTPSGF 82 >ref|XP_003547349.1| PREDICTED: nuclear export mediator factor NEMF homolog [Glycine max] Length = 1119 Score = 127 bits (319), Expect = 9e-28 Identities = 64/82 (78%), Positives = 66/82 (80%) Frame = +3 Query: 216 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLTPKTYVFKLMNXXXXXXXXXXXXXXXXM 395 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDL+PKTYVFKLMN M Sbjct: 1 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLSPKTYVFKLMNSSGVSESGESEKVLLLM 60 Query: 396 ESGVRLHTTVYMRDKSNTPSGF 461 ESGVRLHTT+YMRDKSNTPSGF Sbjct: 61 ESGVRLHTTLYMRDKSNTPSGF 82 >ref|XP_002519281.1| conserved hypothetical protein [Ricinus communis] gi|223541596|gb|EEF43145.1| conserved hypothetical protein [Ricinus communis] Length = 1092 Score = 125 bits (314), Expect = 4e-27 Identities = 63/82 (76%), Positives = 65/82 (79%) Frame = +3 Query: 216 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLTPKTYVFKLMNXXXXXXXXXXXXXXXXM 395 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDL+PKTYVFKLMN M Sbjct: 1 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLSPKTYVFKLMNSSGVTESGESEKVLLLM 60 Query: 396 ESGVRLHTTVYMRDKSNTPSGF 461 ESGVRLHTT Y+RDKSNTPSGF Sbjct: 61 ESGVRLHTTAYVRDKSNTPSGF 82 >ref|XP_003533123.1| PREDICTED: nuclear export mediator factor Nemf-like [Glycine max] Length = 1131 Score = 125 bits (313), Expect = 5e-27 Identities = 62/82 (75%), Positives = 66/82 (80%) Frame = +3 Query: 216 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLTPKTYVFKLMNXXXXXXXXXXXXXXXXM 395 MVKVR+NTADVAAEVKCLRRLIGMRCSNVYDL+PKTYVFKLMN M Sbjct: 1 MVKVRLNTADVAAEVKCLRRLIGMRCSNVYDLSPKTYVFKLMNSSGVSESGESEKVLLLM 60 Query: 396 ESGVRLHTTVYMRDKSNTPSGF 461 ESGVRLHTT+Y+RDKSNTPSGF Sbjct: 61 ESGVRLHTTLYLRDKSNTPSGF 82 >ref|XP_004157045.1| PREDICTED: nuclear export mediator factor NEMF homolog [Cucumis sativus] Length = 1090 Score = 121 bits (303), Expect = 7e-26 Identities = 60/82 (73%), Positives = 65/82 (79%) Frame = +3 Query: 216 MVKVRMNTADVAAEVKCLRRLIGMRCSNVYDLTPKTYVFKLMNXXXXXXXXXXXXXXXXM 395 MVKVRMNTADVAAEVKCL+RLIGMRC+NVYDL+PKTY+FKLMN M Sbjct: 1 MVKVRMNTADVAAEVKCLKRLIGMRCANVYDLSPKTYMFKLMNSSGVTESGESEKVLLLM 60 Query: 396 ESGVRLHTTVYMRDKSNTPSGF 461 ESGVRLHTT Y+RDKSNTPSGF Sbjct: 61 ESGVRLHTTEYVRDKSNTPSGF 82