BLASTX nr result
ID: Glycyrrhiza23_contig00019088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019088 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144328.1| PREDICTED: probable auxin efflux carrier com... 102 3e-20 gb|ABQ95663.1| auxin efflux carrier, partial [Malus x domestica] 102 3e-20 gb|ABQ95664.1| auxin efflux carrier, partial [Malus x domestica] 102 3e-20 gb|ABQ95658.1| auxin efflux carrier, partial [Malus x domestica] 102 3e-20 gb|AFK46028.1| unknown [Lotus japonicus] 102 3e-20 >ref|XP_004144328.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cucumis sativus] gi|449488241|ref|XP_004157978.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cucumis sativus] Length = 596 Score = 102 bits (254), Expect = 3e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 411 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 259 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 546 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 596 >gb|ABQ95663.1| auxin efflux carrier, partial [Malus x domestica] Length = 481 Score = 102 bits (254), Expect = 3e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 411 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 259 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 431 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 481 >gb|ABQ95664.1| auxin efflux carrier, partial [Malus x domestica] Length = 481 Score = 102 bits (254), Expect = 3e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 411 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 259 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 431 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 481 >gb|ABQ95658.1| auxin efflux carrier, partial [Malus x domestica] Length = 483 Score = 102 bits (254), Expect = 3e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 411 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 259 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 433 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 483 >gb|AFK46028.1| unknown [Lotus japonicus] Length = 493 Score = 102 bits (254), Expect = 3e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 411 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 259 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 439 AIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 489