BLASTX nr result
ID: Glycyrrhiza23_contig00018863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00018863 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530892.1| PREDICTED: uncharacterized protein LOC100794... 59 5e-07 ref|XP_003623040.1| hypothetical protein MTR_7g060450 [Medicago ... 59 5e-07 ref|XP_003552161.1| PREDICTED: uncharacterized protein LOC100814... 58 7e-07 >ref|XP_003530892.1| PREDICTED: uncharacterized protein LOC100794871 [Glycine max] Length = 180 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 PRLVWHGSDVCDSEVTPFGLKKKRKVHVSD 92 PR VWHGSDVCDSEVTPFGLKKKR V+V++ Sbjct: 149 PRHVWHGSDVCDSEVTPFGLKKKRNVYVNN 178 >ref|XP_003623040.1| hypothetical protein MTR_7g060450 [Medicago truncatula] gi|358345005|ref|XP_003636575.1| hypothetical protein MTR_046s0014 [Medicago truncatula] gi|355498055|gb|AES79258.1| hypothetical protein MTR_7g060450 [Medicago truncatula] gi|355502510|gb|AES83713.1| hypothetical protein MTR_046s0014 [Medicago truncatula] Length = 188 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 PRLVWHGSDVCDSEVTPFGLKKKRKVHVSDP 95 PR VWHGSDVCDSEVTPFGL KKRKVHV +P Sbjct: 159 PRHVWHGSDVCDSEVTPFGL-KKRKVHVENP 188 >ref|XP_003552161.1| PREDICTED: uncharacterized protein LOC100814114 [Glycine max] Length = 188 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 3 PRLVWHGSDVCDSEVTPFGLKKKRKVHVSDP 95 PR VWHGSDVCDSEVTPFGLKKKR +V+ P Sbjct: 158 PRHVWHGSDVCDSEVTPFGLKKKRNAYVNIP 188