BLASTX nr result
ID: Glycyrrhiza23_contig00018768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00018768 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621609.1| WPP domain-interacting tail-anchored protein... 77 1e-12 ref|XP_003551786.1| PREDICTED: WPP domain-interacting tail-ancho... 60 2e-07 >ref|XP_003621609.1| WPP domain-interacting tail-anchored protein [Medicago truncatula] gi|355496624|gb|AES77827.1| WPP domain-interacting tail-anchored protein [Medicago truncatula] Length = 626 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -1 Query: 303 MPDVGTVRRIDAGALNFKHLFISVFVLLLSAVTYLYFKDVNVDFSL 166 +PDVGTVRRIDAG L FKHL IS+FVLLLSAVT+LYFKD+NVD L Sbjct: 581 IPDVGTVRRIDAGVLTFKHLLISLFVLLLSAVTFLYFKDLNVDVRL 626 >ref|XP_003551786.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like [Glycine max] Length = 632 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/47 (72%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -1 Query: 303 MPDVGTVRRIDAGALNFKHLF-ISVFVLLLSAVTYLYFKDVNVDFSL 166 MPD GTVRRIDAG LNFKHLF +SV VLL SAVTYL NVD +L Sbjct: 591 MPDAGTVRRIDAGVLNFKHLFMLSVLVLLFSAVTYL-----NVDANL 632