BLASTX nr result
ID: Glycyrrhiza23_contig00018339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00018339 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541933.1| PREDICTED: probable histone-lysine N-methylt... 60 2e-07 ref|XP_003597050.1| Histone-lysine N-methyltransferase E(z) [Med... 55 6e-06 >ref|XP_003541933.1| PREDICTED: probable histone-lysine N-methyltransferase ATXR3-like [Glycine max] Length = 2351 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 136 MGDGGVTCMPLQYIMERLPSSEKTLCGGKRG 228 MGDGGV CMPLQYIMERLPS+EKT+C GK G Sbjct: 1 MGDGGVACMPLQYIMERLPSAEKTVCRGKSG 31 >ref|XP_003597050.1| Histone-lysine N-methyltransferase E(z) [Medicago truncatula] gi|355486098|gb|AES67301.1| Histone-lysine N-methyltransferase E(z) [Medicago truncatula] Length = 2512 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 136 MGDGGVTCMPLQYIMERLPSSEKTLCGGKR 225 MGDGGVTCMPLQYIME++ SSEK+ CGG + Sbjct: 1 MGDGGVTCMPLQYIMEKISSSEKSHCGGSK 30