BLASTX nr result
ID: Glycyrrhiza23_contig00017874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00017874 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB33420.1| putative senescence-associated protein [Pisum sa... 60 2e-07 >dbj|BAB33420.1| putative senescence-associated protein [Pisum sativum] Length = 253 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/41 (65%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = -1 Query: 143 IIGCHNMQTSIFNCSCSLSNLDDVLIY--KQCESQPMNTCW 27 IIG HNMQT +F+ SC LS+LD++LIY KQC SQPM++CW Sbjct: 148 IIGTHNMQTPMFSLSCLLSDLDEMLIYIHKQCGSQPMSSCW 188