BLASTX nr result
ID: Glycyrrhiza23_contig00017839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00017839 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC62104.2| auxin-repressed protein [Elaeagnus umbellata] 94 1e-17 ref|XP_002279836.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 94 1e-17 ref|XP_002509446.1| Auxin-repressed 12.5 kDa protein, putative [... 94 1e-17 gb|ADB02903.1| auxin-repressed protein-like protein ARP1 [Jatrop... 92 4e-17 gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] 91 7e-17 >gb|AAC62104.2| auxin-repressed protein [Elaeagnus umbellata] Length = 120 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = +1 Query: 1 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTAGSPTVYDWLYSGETRSKHR 153 RK+NVWRSVFNPGSNLAT+G G+ FDKPS SPTVYDWLYSGETRSKHR Sbjct: 70 RKENVWRSVFNPGSNLATRGLGTEMFDKPSQPNSPTVYDWLYSGETRSKHR 120 >ref|XP_002279836.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform 1 [Vitis vinifera] gi|359483595|ref|XP_003632984.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform 2 [Vitis vinifera] gi|147774462|emb|CAN59795.1| hypothetical protein VITISV_001903 [Vitis vinifera] gi|297740413|emb|CBI30595.3| unnamed protein product [Vitis vinifera] Length = 121 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +1 Query: 1 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTAGSPTVYDWLYSGETRSKH 150 RKDNVWRSVF+PGSNLATKG GS+YFDKP+ +PTVYDWLYSGETR+KH Sbjct: 70 RKDNVWRSVFHPGSNLATKGMGSDYFDKPTKKDTPTVYDWLYSGETRTKH 119 >ref|XP_002509446.1| Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] gi|223549345|gb|EEF50833.1| Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] Length = 118 Score = 93.6 bits (231), Expect = 1e-17 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = +1 Query: 1 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTAGSPTVYDWLYSGETRSKHR 153 RKDNVWRSVF+PGSNLAT+G G+ FDKPS SPTVYDWLYSGETRSKHR Sbjct: 68 RKDNVWRSVFHPGSNLATRGIGAQLFDKPSQPNSPTVYDWLYSGETRSKHR 118 >gb|ADB02903.1| auxin-repressed protein-like protein ARP1 [Jatropha curcas] Length = 120 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 1 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTAGSPTVYDWLYSGETRSKHR 153 RKDNVWRSVF+PGSNLATKG G+ FDKP SPTVYDWLYSG+TRSKHR Sbjct: 70 RKDNVWRSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 120 >gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] Length = 119 Score = 91.3 bits (225), Expect = 7e-17 Identities = 44/51 (86%), Positives = 44/51 (86%) Frame = +1 Query: 1 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTAGSPTVYDWLYSGETRSKHR 153 RKDNVWRSVFNPGSNLATKG GS FDKP SPTVYDWLYSGETRSKHR Sbjct: 70 RKDNVWRSVFNPGSNLATKGLGSALFDKPE-PNSPTVYDWLYSGETRSKHR 119