BLASTX nr result
ID: Glycyrrhiza23_contig00017668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00017668 (624 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR29644.1| manganese superoxide dismutase-like protein [Pist... 106 3e-21 gb|ABK32075.1| manganese superoxide dismutase [Acanthus ebractea... 106 3e-21 gb|AAN15216.1| manganese superoxide dismutase [Avicennia marina] 106 3e-21 gb|ABH11434.2| Mn-superoxide dismutase II [Helianthus annuus] 105 5e-21 gb|AFH08815.1| chloroplast Mn-superoxide dismutase 1C-a [Prunus ... 105 7e-21 >gb|ABR29644.1| manganese superoxide dismutase-like protein [Pistacia vera] Length = 230 Score = 106 bits (265), Expect = 3e-21 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +1 Query: 1 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 141 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK Sbjct: 173 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 219 >gb|ABK32075.1| manganese superoxide dismutase [Acanthus ebracteatus] Length = 224 Score = 106 bits (265), Expect = 3e-21 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +1 Query: 1 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 141 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK Sbjct: 167 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 213 >gb|AAN15216.1| manganese superoxide dismutase [Avicennia marina] Length = 226 Score = 106 bits (265), Expect = 3e-21 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +1 Query: 1 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 141 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK Sbjct: 168 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 214 >gb|ABH11434.2| Mn-superoxide dismutase II [Helianthus annuus] Length = 228 Score = 105 bits (263), Expect = 5e-21 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 141 NQDPLVTKGPSLVPL+GIDVWEHAYYLQYKNVRPDYLKNIWKVINWK Sbjct: 171 NQDPLVTKGPSLVPLIGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 217 >gb|AFH08815.1| chloroplast Mn-superoxide dismutase 1C-a [Prunus persica] Length = 237 Score = 105 bits (262), Expect = 7e-21 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 NQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 141 NQDPLVTKGP+LVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK Sbjct: 180 NQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWK 226