BLASTX nr result
ID: Glycyrrhiza23_contig00017321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00017321 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538978.1| PREDICTED: pentatricopeptide repeat-containi... 54 3e-07 >ref|XP_003538978.1| PREDICTED: pentatricopeptide repeat-containing protein At1g50270-like [Glycine max] Length = 560 Score = 54.3 bits (129), Expect(2) = 3e-07 Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +2 Query: 176 KYFVGMKSRSNKIDGXXXXXXXXXXA-GG**YFGKWVHGFYVEERRVSLDGYICSAVVNM 352 K FV M+ R +D A G FG+WVHGFYVE RV LDGY+ SA+++M Sbjct: 194 KCFVKMRLRDRSVDAVTVASILRAAALVGDADFGRWVHGFYVEAGRVQLDGYVFSALMDM 253 Query: 353 YFQ 361 YF+ Sbjct: 254 YFK 256 Score = 25.0 bits (53), Expect(2) = 3e-07 Identities = 7/18 (38%), Positives = 15/18 (83%) Frame = +3 Query: 360 KCRNSDDDCKLYDKMPNR 413 KC + +D CK+++++P+R Sbjct: 256 KCGHCEDACKVFNELPHR 273