BLASTX nr result
ID: Glycyrrhiza23_contig00017037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00017037 (1016 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623229.1| Pentatricopeptide repeat-containing protein ... 98 3e-18 ref|XP_003530271.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-15 emb|CBI24253.3| unnamed protein product [Vitis vinifera] 72 2e-10 ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_002313262.1| predicted protein [Populus trichocarpa] gi|2... 59 2e-06 >ref|XP_003623229.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498244|gb|AES79447.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 770 Score = 98.2 bits (243), Expect = 3e-18 Identities = 46/52 (88%), Positives = 51/52 (98%) Frame = -3 Query: 1014 SKLTSTILACLCNISEDLDIKKILPKFSQHTSEGASIKCNELLMKLNKVHPE 859 SKLTSTILACLCN+S+D+DI+KILPKFSQHTS GASIKCNELLMKLNKVHP+ Sbjct: 656 SKLTSTILACLCNMSKDVDIEKILPKFSQHTSVGASIKCNELLMKLNKVHPD 707 >ref|XP_003530271.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Glycine max] Length = 703 Score = 88.6 bits (218), Expect = 2e-15 Identities = 43/61 (70%), Positives = 53/61 (86%), Gaps = 3/61 (4%) Frame = -3 Query: 1014 SKLTSTILACLCNISEDLDIKKILPKFSQ---HTSEGASIKCNELLMKLNKVHPELQLFV 844 SKLTSTILACLC++S +LD++KILPKFSQ HTS+G +IKC+ELLM+LN HPEL+L V Sbjct: 642 SKLTSTILACLCHMSRNLDVEKILPKFSQQSEHTSKGTTIKCHELLMRLNNFHPELKLIV 701 Query: 843 A 841 A Sbjct: 702 A 702 >emb|CBI24253.3| unnamed protein product [Vitis vinifera] Length = 582 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/54 (59%), Positives = 44/54 (81%) Frame = -3 Query: 1011 KLTSTILACLCNISEDLDIKKILPKFSQHTSEGASIKCNELLMKLNKVHPELQL 850 K+ STIL CLC+ +++D+ ++LP F Q TSEGASI CNELLM+L++ HP+LQL Sbjct: 526 KIVSTILTCLCHSIQEVDVMELLPTFFQGTSEGASISCNELLMQLHQSHPKLQL 579 >ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Vitis vinifera] Length = 728 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/54 (59%), Positives = 44/54 (81%) Frame = -3 Query: 1011 KLTSTILACLCNISEDLDIKKILPKFSQHTSEGASIKCNELLMKLNKVHPELQL 850 K+ STIL CLC+ +++D+ ++LP F Q TSEGASI CNELLM+L++ HP+LQL Sbjct: 672 KIVSTILTCLCHSIQEVDVMELLPTFFQGTSEGASISCNELLMQLHQSHPKLQL 725 >ref|XP_002313262.1| predicted protein [Populus trichocarpa] gi|222849670|gb|EEE87217.1| predicted protein [Populus trichocarpa] Length = 559 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/57 (45%), Positives = 41/57 (71%) Frame = -3 Query: 1011 KLTSTILACLCNISEDLDIKKILPKFSQHTSEGASIKCNELLMKLNKVHPELQLFVA 841 ++T++IL LCN +E L + ++LP FS +S G SI C++LLMK+ K +P+LQ+ A Sbjct: 503 EITNSILTFLCNSAEHLHVMELLPNFSSESSGGTSISCDKLLMKIQKFNPKLQISAA 559