BLASTX nr result
ID: Glycyrrhiza23_contig00017034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00017034 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512002.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 >ref|XP_002512002.1| conserved hypothetical protein [Ricinus communis] gi|223549182|gb|EEF50671.1| conserved hypothetical protein [Ricinus communis] Length = 125 Score = 68.2 bits (165), Expect = 7e-10 Identities = 40/76 (52%), Positives = 47/76 (61%), Gaps = 5/76 (6%) Frame = -2 Query: 307 PFFAVMSVLTLLAVLSCYLGRRWSRRATTT-----PLESITRDTNRDYFGWVKRLYRECT 143 PFF V+SVLT+LA+LSC LGR SRRA P+ +I +RDYFGW+KR R C Sbjct: 45 PFFGVISVLTVLAILSCILGRVCSRRAEAAVGGGGPVGAI---KHRDYFGWMKRKSRWCR 101 Query: 142 AISKHVGAKVMVYGQE 95 VGAKVM QE Sbjct: 102 GGDVEVGAKVMALDQE 117