BLASTX nr result
ID: Glycyrrhiza23_contig00016943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00016943 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614649.1| Cytochrome P450 71D95 [Medicago truncatula] ... 59 5e-07 dbj|BAA84916.1| cytochrome P450 [Cicer arietinum] 57 2e-06 >ref|XP_003614649.1| Cytochrome P450 71D95 [Medicago truncatula] gi|355515984|gb|AES97607.1| Cytochrome P450 71D95 [Medicago truncatula] Length = 425 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 25 LKPEEMDMSHMFGVTLHKAQPLRVVPIK 108 LKP++MDMSHMFGVTLHKAQPLRVVPIK Sbjct: 397 LKPDDMDMSHMFGVTLHKAQPLRVVPIK 424 >dbj|BAA84916.1| cytochrome P450 [Cicer arietinum] Length = 381 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 4 NGSLLMGLKPEEMDMSHMFGVTLHKAQPLRVVPIK 108 N L LKP++MDMSH FGVTLHKAQPLRVVPIK Sbjct: 346 NFKLADDLKPDDMDMSHKFGVTLHKAQPLRVVPIK 380