BLASTX nr result
ID: Glycyrrhiza23_contig00016922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00016922 (646 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594540.1| hypothetical protein MTR_2g030380 [Medicago ... 75 8e-12 ref|XP_003547329.1| PREDICTED: probable LRR receptor-like serine... 71 2e-10 emb|CBI31028.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002264110.1| PREDICTED: probable LRR receptor-like serine... 71 2e-10 ref|XP_002264039.1| PREDICTED: probable LRR receptor-like serine... 71 2e-10 >ref|XP_003594540.1| hypothetical protein MTR_2g030380 [Medicago truncatula] gi|355483588|gb|AES64791.1| hypothetical protein MTR_2g030380 [Medicago truncatula] Length = 1048 Score = 75.5 bits (184), Expect = 8e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 102 GQLPSQDILALLEFKKCIKHDPTGYVLNSWNEES 1 GQLPSQDILALLEFKKCIKHDPTGYVLNSWNEES Sbjct: 2 GQLPSQDILALLEFKKCIKHDPTGYVLNSWNEES 35 >ref|XP_003547329.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like [Glycine max] Length = 1002 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 102 GQLPSQDILALLEFKKCIKHDPTGYVLNSWNEES 1 GQLPSQDILALLEFKK IKHDPTGYVLNSWNEES Sbjct: 18 GQLPSQDILALLEFKKGIKHDPTGYVLNSWNEES 51 >emb|CBI31028.3| unnamed protein product [Vitis vinifera] Length = 908 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 102 GQLPSQDILALLEFKKCIKHDPTGYVLNSWNEES 1 GQLPSQDILALLEFKK IKHDPTGYVLNSWNEES Sbjct: 2 GQLPSQDILALLEFKKGIKHDPTGYVLNSWNEES 35 >ref|XP_002264110.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like isoform 2 [Vitis vinifera] Length = 987 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 102 GQLPSQDILALLEFKKCIKHDPTGYVLNSWNEES 1 GQLPSQDILALLEFKK IKHDPTGYVLNSWNEES Sbjct: 2 GQLPSQDILALLEFKKGIKHDPTGYVLNSWNEES 35 >ref|XP_002264039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like isoform 1 [Vitis vinifera] Length = 1064 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 102 GQLPSQDILALLEFKKCIKHDPTGYVLNSWNEES 1 GQLPSQDILALLEFKK IKHDPTGYVLNSWNEES Sbjct: 19 GQLPSQDILALLEFKKGIKHDPTGYVLNSWNEES 52