BLASTX nr result
ID: Glycyrrhiza23_contig00016721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00016721 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548904.1| PREDICTED: BEL1-like homeodomain protein 2-l... 59 3e-07 gb|AAF43095.1|AF053769_1 homeodomain protein [Malus x domestica] 57 2e-06 >ref|XP_003548904.1| PREDICTED: BEL1-like homeodomain protein 2-like [Glycine max] Length = 754 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/48 (64%), Positives = 34/48 (70%), Gaps = 3/48 (6%) Frame = -2 Query: 227 IRRDKVRVQGFDXXXXXPLIGIEEEVPA---VYETTGMLSEMFNFPPG 93 IRRDKVRVQGF+ L+ IEE+ VYET GMLSEMFNFPPG Sbjct: 75 IRRDKVRVQGFEPPPQQTLLPIEEDESGSLPVYETAGMLSEMFNFPPG 122 >gb|AAF43095.1|AF053769_1 homeodomain protein [Malus x domestica] Length = 809 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 4/49 (8%) Frame = -2 Query: 227 IRRDKVRVQGFDXXXXXPLIGIEEE----VPAVYETTGMLSEMFNFPPG 93 IRR+K+RVQGF+ PL+G+ EE +PA YET GMLSEMFN+PPG Sbjct: 75 IRREKLRVQGFETPPPPPLVGLNEEESSGLPA-YETAGMLSEMFNYPPG 122