BLASTX nr result
ID: Glycyrrhiza23_contig00016719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00016719 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612113.1| Transmembrane and coiled-coil domain-contain... 73 3e-11 ref|XP_003612112.1| Transmembrane and coiled-coil domain-contain... 73 3e-11 ref|XP_003517195.1| PREDICTED: uncharacterized membrane protein ... 71 1e-10 ref|XP_002272351.1| PREDICTED: transmembrane and coiled-coil dom... 59 5e-07 emb|CAN59788.1| hypothetical protein VITISV_012480 [Vitis vinifera] 59 5e-07 >ref|XP_003612113.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] gi|355513448|gb|AES95071.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] Length = 447 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +3 Query: 168 SPMAAATTSYLTPTQRYAAGALLGLAVHQAQLHQTHPLGLST 293 SP + + SYLTPTQRYAAGAL GLA+HQAQLHQTHPLGLST Sbjct: 6 SPSPSPSPSYLTPTQRYAAGALFGLALHQAQLHQTHPLGLST 47 >ref|XP_003612112.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] gi|355513447|gb|AES95070.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] Length = 717 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +3 Query: 168 SPMAAATTSYLTPTQRYAAGALLGLAVHQAQLHQTHPLGLST 293 SP + + SYLTPTQRYAAGAL GLA+HQAQLHQTHPLGLST Sbjct: 6 SPSPSPSPSYLTPTQRYAAGALFGLALHQAQLHQTHPLGLST 47 >ref|XP_003517195.1| PREDICTED: uncharacterized membrane protein F35D11.3-like [Glycine max] Length = 667 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 180 AATTSYLTPTQRYAAGALLGLAVHQAQLHQTHPLGLST 293 AA TSYLT TQRYAAGAL GLA+HQAQLHQTHPLGLST Sbjct: 2 AAATSYLTGTQRYAAGALFGLALHQAQLHQTHPLGLST 39 >ref|XP_002272351.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 4 [Vitis vinifera] gi|297735050|emb|CBI17412.3| unnamed protein product [Vitis vinifera] Length = 662 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 189 TSYLTPTQRYAAGALLGLAVHQAQLHQTHPLGLS 290 +S+LTPTQRYAAGALLGLA+ QAQ+HQT PLG S Sbjct: 2 SSFLTPTQRYAAGALLGLALQQAQIHQTRPLGSS 35 >emb|CAN59788.1| hypothetical protein VITISV_012480 [Vitis vinifera] Length = 670 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 189 TSYLTPTQRYAAGALLGLAVHQAQLHQTHPLGLS 290 +S+LTPTQRYAAGALLGLA+ QAQ+HQT PLG S Sbjct: 2 SSFLTPTQRYAAGALLGLALQQAQIHQTRPLGSS 35