BLASTX nr result
ID: Glycyrrhiza23_contig00016047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00016047 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516745.1| Ran GTPase binding protein, putative [Ricinu... 80 1e-13 ref|XP_003555124.1| PREDICTED: probable E3 ubiquitin-protein lig... 70 2e-10 ref|XP_002283479.1| PREDICTED: E3 ubiquitin-protein ligase HERC2... 63 2e-08 ref|XP_002329325.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_004156186.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ... 57 1e-06 >ref|XP_002516745.1| Ran GTPase binding protein, putative [Ricinus communis] gi|223544118|gb|EEF45643.1| Ran GTPase binding protein, putative [Ricinus communis] Length = 393 Score = 80.5 bits (197), Expect = 1e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +3 Query: 6 NIPPPQNLSGSAAAEGHWIAKLVACGGRHTLAMVEWKVDESK 131 +IPPP++LSG+ AEGHWIAKLVACGGRHTLA+VEWKVDESK Sbjct: 352 DIPPPKSLSGTEEAEGHWIAKLVACGGRHTLAIVEWKVDESK 393 >ref|XP_003555124.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Glycine max] Length = 395 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 INIPPPQNLSGSAAAEGHWIAKLVACGGRHTLAMVEWKVDES 128 I++PPPQ+ SG+A EGHWIAKLVACGGRHTLA+VEWK +ES Sbjct: 355 IDLPPPQDPSGTAT-EGHWIAKLVACGGRHTLAIVEWKSNES 395 >ref|XP_002283479.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Vitis vinifera] gi|296087299|emb|CBI33673.3| unnamed protein product [Vitis vinifera] Length = 395 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 3 INIPPPQNLSGSAAAEGHWIAKLVACGGRHTLAMVEWKVDE 125 IN+PP NLSGS A GHW +KLVACGGRHTLA+VEW E Sbjct: 351 INLPPATNLSGSGAG-GHWCSKLVACGGRHTLAIVEWLAHE 390 >ref|XP_002329325.1| predicted protein [Populus trichocarpa] gi|222870779|gb|EEF07910.1| predicted protein [Populus trichocarpa] Length = 392 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +3 Query: 3 INIPPPQNLSGSAAAEGHWIAKLVACGGRHTLAMVEWKVDESK 131 I+IPPP+NL+ S A G WIAKLVA GGRHTLA+VEW +SK Sbjct: 351 IDIPPPKNLTDSGDA-GRWIAKLVASGGRHTLAIVEWHTGDSK 392 >ref|XP_004156186.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein ligase HERC1-like [Cucumis sativus] Length = 390 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 3 INIPPPQNLSGSAAAEGHWIAKLVACGGRHTLAMVEWKVDE 125 I+IPPP+ + + GHWIAKLVACGGRHTLA+V+WK ++ Sbjct: 351 IDIPPPRGRTEN----GHWIAKLVACGGRHTLALVQWKPED 387