BLASTX nr result
ID: Glycyrrhiza23_contig00016046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00016046 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516745.1| Ran GTPase binding protein, putative [Ricinu... 75 4e-12 ref|XP_003555124.1| PREDICTED: probable E3 ubiquitin-protein lig... 73 3e-11 ref|XP_002283479.1| PREDICTED: E3 ubiquitin-protein ligase HERC2... 67 2e-09 ref|XP_002329325.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_004156186.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ... 60 2e-07 >ref|XP_002516745.1| Ran GTPase binding protein, putative [Ricinus communis] gi|223544118|gb|EEF45643.1| Ran GTPase binding protein, putative [Ricinus communis] Length = 393 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/42 (83%), Positives = 39/42 (92%), Gaps = 1/42 (2%) Frame = +3 Query: 6 NIPPPHNLSGSA-AEGHWIAKLVACGGRHTLAMVEWKVDESK 128 +IPPP +LSG+ AEGHWIAKLVACGGRHTLA+VEWKVDESK Sbjct: 352 DIPPPKSLSGTEEAEGHWIAKLVACGGRHTLAIVEWKVDESK 393 >ref|XP_003555124.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Glycine max] Length = 395 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 INIPPPHNLSGSAAEGHWIAKLVACGGRHTLAMVEWKVDES 125 I++PPP + SG+A EGHWIAKLVACGGRHTLA+VEWK +ES Sbjct: 355 IDLPPPQDPSGTATEGHWIAKLVACGGRHTLAIVEWKSNES 395 >ref|XP_002283479.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Vitis vinifera] gi|296087299|emb|CBI33673.3| unnamed protein product [Vitis vinifera] Length = 395 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 3 INIPPPHNLSGSAAEGHWIAKLVACGGRHTLAMVEWKVDE 122 IN+PP NLSGS A GHW +KLVACGGRHTLA+VEW E Sbjct: 351 INLPPATNLSGSGAGGHWCSKLVACGGRHTLAIVEWLAHE 390 >ref|XP_002329325.1| predicted protein [Populus trichocarpa] gi|222870779|gb|EEF07910.1| predicted protein [Populus trichocarpa] Length = 392 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 3 INIPPPHNLSGSAAEGHWIAKLVACGGRHTLAMVEWKVDESK 128 I+IPPP NL+ S G WIAKLVA GGRHTLA+VEW +SK Sbjct: 351 IDIPPPKNLTDSGDAGRWIAKLVASGGRHTLAIVEWHTGDSK 392 >ref|XP_004156186.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein ligase HERC1-like [Cucumis sativus] Length = 390 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 3 INIPPPHNLSGSAAEGHWIAKLVACGGRHTLAMVEWKVDE 122 I+IPPP G GHWIAKLVACGGRHTLA+V+WK ++ Sbjct: 351 IDIPPPR---GRTENGHWIAKLVACGGRHTLALVQWKPED 387