BLASTX nr result
ID: Glycyrrhiza23_contig00015894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015894 (626 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539889.1| PREDICTED: uncharacterized protein LOC100791... 91 2e-16 ref|NP_001119011.1| uncharacerized protein [Arabidopsis thaliana... 63 4e-08 ref|XP_002862750.1| expressed protein [Arabidopsis lyrata subsp.... 57 2e-06 ref|NP_001119378.1| conserved peptide upstream open reading fram... 55 8e-06 >ref|XP_003539889.1| PREDICTED: uncharacterized protein LOC100791461 [Glycine max] Length = 41 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 235 MEGVCFWTNCYQYRFFAFQEVLDWRFFILGDFLLVSFVNCT 113 MEGVCFWTNCYQYRFFAFQEVLDWR FILGDFL VSFVNCT Sbjct: 1 MEGVCFWTNCYQYRFFAFQEVLDWRVFILGDFLRVSFVNCT 41 >ref|NP_001119011.1| uncharacerized protein [Arabidopsis thaliana] gi|332658744|gb|AEE84144.1| uncharacerized protein [Arabidopsis thaliana] Length = 41 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -2 Query: 235 MEGVCFWTNCYQYRFFAFQEVLDWRFFILGDFLLVSFVNCT 113 ME V W +CY YR F+FQE LDWRF + DFL+ SFVNCT Sbjct: 1 MEQVFVWPSCYHYRLFSFQEALDWRFLVRSDFLVGSFVNCT 41 >ref|XP_002862750.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297308458|gb|EFH39008.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 49 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = -2 Query: 235 MEGVCFWTNCYQYRFFAFQEVLDWRFFILGDFLLVSFVNCT*C 107 ME + CYQYR F+ QE LDWRF + DFL+ SFVNCT C Sbjct: 1 MEQDYICSGCYQYRVFSLQEALDWRFLVHSDFLIGSFVNCTYC 43 >ref|NP_001119378.1| conserved peptide upstream open reading frame 24 [Arabidopsis thaliana] gi|332007868|gb|AED95251.1| conserved peptide upstream open reading frame 24 [Arabidopsis thaliana] Length = 41 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = -2 Query: 235 MEGVCFWTNCYQYRFFAFQEVLDWRFFILGDFLLVSFVNCT 113 ME + CYQYR F+ QE LDWRF + DFL+ SFVNCT Sbjct: 1 MEQDYICSGCYQYRVFSLQEALDWRFLVHSDFLIGSFVNCT 41