BLASTX nr result
ID: Glycyrrhiza23_contig00015874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015874 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516750.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 >ref|XP_003516750.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13270, chloroplastic-like [Glycine max] Length = 765 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = -2 Query: 138 PVVVANDKNNGVRHTKFAQIPXXXXXXXXXXSLMTHKNQQGQLENL 1 P+VVANDKNN RH FAQIP SL TH+NQQGQ+ENL Sbjct: 17 PIVVANDKNNDARHANFAQIPSWVSLKSSHSSLRTHQNQQGQVENL 62