BLASTX nr result
ID: Glycyrrhiza23_contig00015844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015844 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525716.1| PREDICTED: low affinity cationic amino acid ... 107 1e-21 ref|XP_004149102.1| PREDICTED: cationic amino acid transporter 2... 99 4e-19 ref|XP_002525690.1| cationic amino acid transporter, putative [R... 99 4e-19 gb|AFM93785.1| cationic amino acid transporter 2 [Solanum lycope... 98 8e-19 ref|XP_002319189.1| cationic amino acid transporter [Populus tri... 98 8e-19 >ref|XP_003525716.1| PREDICTED: low affinity cationic amino acid transporter 2-like [Glycine max] Length = 640 Score = 107 bits (267), Expect = 1e-21 Identities = 55/70 (78%), Positives = 57/70 (81%) Frame = +3 Query: 3 AKELTVPHLMXXXXXXXXXXXXYVLVGTVAREHAGPAMPLSFLVAGFAAALSALCYAELA 182 AKELTVPHLM YVLVGTVAREH+G A+PLSFLVAGFAAALSALCYAELA Sbjct: 41 AKELTVPHLMAIGVGATIGAGVYVLVGTVAREHSGAALPLSFLVAGFAAALSALCYAELA 100 Query: 183 SRCPSAGSAY 212 SRCPSAGSAY Sbjct: 101 SRCPSAGSAY 110 >ref|XP_004149102.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Cucumis sativus] gi|449511751|ref|XP_004164044.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Cucumis sativus] Length = 655 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/70 (68%), Positives = 55/70 (78%) Frame = +3 Query: 3 AKELTVPHLMXXXXXXXXXXXXYVLVGTVAREHAGPAMPLSFLVAGFAAALSALCYAELA 182 AKEL+VPHL+ Y+LVGTVAREH+GPA+ +SFL+AG AAALSA CYAELA Sbjct: 48 AKELSVPHLISIGVGATIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 107 Query: 183 SRCPSAGSAY 212 SRCPSAGSAY Sbjct: 108 SRCPSAGSAY 117 >ref|XP_002525690.1| cationic amino acid transporter, putative [Ricinus communis] gi|223534990|gb|EEF36673.1| cationic amino acid transporter, putative [Ricinus communis] Length = 643 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/70 (68%), Positives = 55/70 (78%) Frame = +3 Query: 3 AKELTVPHLMXXXXXXXXXXXXYVLVGTVAREHAGPAMPLSFLVAGFAAALSALCYAELA 182 AKEL+VPHL+ Y+LVGTVAREH+GPA+ +SFL+AG AAALSA CYAELA Sbjct: 44 AKELSVPHLIAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 103 Query: 183 SRCPSAGSAY 212 SRCPSAGSAY Sbjct: 104 SRCPSAGSAY 113 >gb|AFM93785.1| cationic amino acid transporter 2 [Solanum lycopersicum] Length = 650 Score = 97.8 bits (242), Expect = 8e-19 Identities = 47/70 (67%), Positives = 54/70 (77%) Frame = +3 Query: 3 AKELTVPHLMXXXXXXXXXXXXYVLVGTVAREHAGPAMPLSFLVAGFAAALSALCYAELA 182 AK LT+PHL+ Y+LVGTVAREH+GPA+ +SFL+AG AAALSA CYAELA Sbjct: 51 AKALTIPHLITIGVGSTIGAGVYILVGTVAREHSGPALTISFLIAGIAAALSAFCYAELA 110 Query: 183 SRCPSAGSAY 212 SRCPSAGSAY Sbjct: 111 SRCPSAGSAY 120 >ref|XP_002319189.1| cationic amino acid transporter [Populus trichocarpa] gi|222857565|gb|EEE95112.1| cationic amino acid transporter [Populus trichocarpa] Length = 640 Score = 97.8 bits (242), Expect = 8e-19 Identities = 48/70 (68%), Positives = 55/70 (78%) Frame = +3 Query: 3 AKELTVPHLMXXXXXXXXXXXXYVLVGTVAREHAGPAMPLSFLVAGFAAALSALCYAELA 182 AKEL+VPHL+ Y+LVGTVAREH+GPA+ +SFL+AG AAALSA CYAELA Sbjct: 40 AKELSVPHLIAIGVGSTIGAGIYILVGTVAREHSGPALFISFLIAGIAAALSAFCYAELA 99 Query: 183 SRCPSAGSAY 212 SRCPSAGSAY Sbjct: 100 SRCPSAGSAY 109