BLASTX nr result
ID: Glycyrrhiza23_contig00015830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015830 (686 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 74 3e-11 ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 74 3e-11 ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago trunca... 73 5e-11 ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 69 1e-09 ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 69 1e-09 >ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max] Length = 438 Score = 73.9 bits (180), Expect = 3e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 686 QRELGYKPTTDLQAGLKKFVRWYLNYYSGGKKAVE 582 Q ELGYKPTTDLQ+GLKKFVRWYLNYYSGGKKAVE Sbjct: 404 QSELGYKPTTDLQSGLKKFVRWYLNYYSGGKKAVE 438 >ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max] Length = 438 Score = 73.9 bits (180), Expect = 3e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 686 QRELGYKPTTDLQAGLKKFVRWYLNYYSGGKKAVE 582 Q ELGYKPTTDLQ+GLKKFVRWYLNYYSGGKKAVE Sbjct: 404 QMELGYKPTTDLQSGLKKFVRWYLNYYSGGKKAVE 438 >ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula] gi|355506193|gb|AES87335.1| UDP-glucuronate 4-epimerase [Medicago truncatula] Length = 440 Score = 73.2 bits (178), Expect = 5e-11 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 686 QRELGYKPTTDLQAGLKKFVRWYLNYYSGGKKAVE 582 QRELGYKP TDLQAGLKKFVRWYLNYYS GKKAVE Sbjct: 406 QRELGYKPVTDLQAGLKKFVRWYLNYYSSGKKAVE 440 >ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus] Length = 432 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 686 QRELGYKPTTDLQAGLKKFVRWYLNYYSGGKKA 588 QRELGYKPTTDLQ GLKKFVRWY+NYYS GKKA Sbjct: 398 QRELGYKPTTDLQTGLKKFVRWYMNYYSQGKKA 430 >ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus] Length = 438 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 686 QRELGYKPTTDLQAGLKKFVRWYLNYYSGGKKA 588 QRELGYKPTTDLQ GLKKFVRWY+NYYS GKKA Sbjct: 404 QRELGYKPTTDLQTGLKKFVRWYMNYYSQGKKA 436