BLASTX nr result
ID: Glycyrrhiza23_contig00015538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015538 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592817.1| Callose synthase [Medicago truncatula] gi|35... 80 2e-13 ref|XP_003551859.1| PREDICTED: callose synthase 3-like [Glycine ... 77 2e-12 ref|XP_003530905.1| PREDICTED: callose synthase 3-like [Glycine ... 77 2e-12 gb|AAK37413.1|AF237733_1 callose synthase 1 catalytic subunit [A... 76 3e-12 gb|AAD30609.1|AC007153_1 Highly similar to putative callose synt... 76 3e-12 >ref|XP_003592817.1| Callose synthase [Medicago truncatula] gi|355481865|gb|AES63068.1| Callose synthase [Medicago truncatula] Length = 1281 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKGRSSRNKE 119 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKGRSSRNKE Sbjct: 1243 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKGRSSRNKE 1281 >ref|XP_003551859.1| PREDICTED: callose synthase 3-like [Glycine max] Length = 1958 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 3 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKGRSSRNKE 119 PFVSEFQTRMLFNQAFSRGLQISRILGGQRK RSSRNKE Sbjct: 1920 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1958 >ref|XP_003530905.1| PREDICTED: callose synthase 3-like [Glycine max] Length = 1958 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 3 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKGRSSRNKE 119 PFVSEFQTRMLFNQAFSRGLQISRILGGQRK RSSRNKE Sbjct: 1920 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1958 >gb|AAK37413.1|AF237733_1 callose synthase 1 catalytic subunit [Arabidopsis thaliana] Length = 1950 Score = 75.9 bits (185), Expect = 3e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 3 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKGRSSRNKE 119 PFVSEFQTRMLFNQAFSRGLQISRILGGQRK RSS+NKE Sbjct: 1912 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 >gb|AAD30609.1|AC007153_1 Highly similar to putative callose synthase catalytic subunit [Arabidopsis thaliana] Length = 1878 Score = 75.9 bits (185), Expect = 3e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 3 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKGRSSRNKE 119 PFVSEFQTRMLFNQAFSRGLQISRILGGQRK RSS+NKE Sbjct: 1840 PFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1878