BLASTX nr result
ID: Glycyrrhiza23_contig00015459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015459 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617518.1| Toll interleukin receptor [Medicago truncatu... 60 2e-07 ref|NP_001240887.1| TMV resistance protein N-like [Glycine max] ... 57 1e-06 gb|ABI16465.1| toll interleukin receptor [Phaseolus vulgaris] 56 3e-06 >ref|XP_003617518.1| Toll interleukin receptor [Medicago truncatula] gi|355518853|gb|AET00477.1| Toll interleukin receptor [Medicago truncatula] Length = 82 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 336 RKWRSALYDVANLKGWHLKFGYEYDLIGKIVETAIK 229 + WRSAL++VANLKG HLK+GYEY+LI KIVE AIK Sbjct: 46 KAWRSALFEVANLKGRHLKYGYEYELIEKIVEMAIK 81 >ref|NP_001240887.1| TMV resistance protein N-like [Glycine max] gi|223452599|gb|ACM89626.1| toll interleukin receptor [Glycine max] Length = 337 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 336 RKWRSALYDVANLKGWHLKFGYEYDLIGKIVETAIK 229 +KWRSAL+DVANLKG++LK GYEY+ I KIVE A K Sbjct: 301 KKWRSALFDVANLKGFYLKTGYEYEFIDKIVEMASK 336 >gb|ABI16465.1| toll interleukin receptor [Phaseolus vulgaris] Length = 337 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 330 WRSALYDVANLKGWHLKFGYEYDLIGKIVETAIK 229 WRSAL++VANLKGW++K GYEY+ I KIVE A K Sbjct: 298 WRSALFEVANLKGWYMKTGYEYEFIEKIVELASK 331