BLASTX nr result
ID: Glycyrrhiza23_contig00015440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015440 (586 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631193.1| PREDICTED: uncharacterized protein LOC100247... 79 7e-13 gb|AAC79140.1| human Mi-2 autoantigen-like protein [Arabidopsis ... 74 2e-11 ref|NP_199293.3| chromatin remodeling 4 protein [Arabidopsis tha... 74 2e-11 ref|XP_002513330.1| conserved hypothetical protein [Ricinus comm... 73 3e-11 ref|XP_002523656.1| chromodomain helicase DNA binding protein, p... 73 3e-11 >ref|XP_003631193.1| PREDICTED: uncharacterized protein LOC100247555 [Vitis vinifera] Length = 2355 Score = 78.6 bits (192), Expect = 7e-13 Identities = 31/66 (46%), Positives = 46/66 (69%), Gaps = 3/66 (4%) Frame = -1 Query: 343 GHDGRYFVCELCN-DGELIRCETCPRIYHIECLD--LKSVPTKEWQCPKCCSNEELSEPI 173 G+DG YF C +C+ G L+ C++CPR YH++CL+ LK +P +WQCPKCC + EP+ Sbjct: 70 GNDGYYFECVICDLGGNLLCCDSCPRTYHLQCLNPPLKRIPNGKWQCPKCCQKSDSLEPM 129 Query: 172 KHLKNL 155 HL ++ Sbjct: 130 SHLDSI 135 >gb|AAC79140.1| human Mi-2 autoantigen-like protein [Arabidopsis thaliana] gi|9758384|dbj|BAB08833.1| helicase-like protein [Arabidopsis thaliana] Length = 2228 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/74 (43%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Frame = -1 Query: 376 SVPRTDGSHEIGHDGRYFVCELCN-DGELIRCETCPRIYHIECLD--LKSVPTKEWQCPK 206 S P + S G+DG YF C +C+ G+L+ C++CPR YH CL+ LK +P +W CPK Sbjct: 45 STPERNSSKRKGNDGNYFECVICDLGGDLLCCDSCPRTYHTACLNPPLKRIPNGKWICPK 104 Query: 205 CCSNEELSEPIKHL 164 C N E +P+ L Sbjct: 105 CSPNSEALKPVNRL 118 >ref|NP_199293.3| chromatin remodeling 4 protein [Arabidopsis thaliana] gi|332007781|gb|AED95164.1| chromatin remodeling 4 protein [Arabidopsis thaliana] Length = 2223 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/74 (43%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Frame = -1 Query: 376 SVPRTDGSHEIGHDGRYFVCELCN-DGELIRCETCPRIYHIECLD--LKSVPTKEWQCPK 206 S P + S G+DG YF C +C+ G+L+ C++CPR YH CL+ LK +P +W CPK Sbjct: 59 STPERNSSKRKGNDGNYFECVICDLGGDLLCCDSCPRTYHTACLNPPLKRIPNGKWICPK 118 Query: 205 CCSNEELSEPIKHL 164 C N E +P+ L Sbjct: 119 CSPNSEALKPVNRL 132 >ref|XP_002513330.1| conserved hypothetical protein [Ricinus communis] gi|223547238|gb|EEF48733.1| conserved hypothetical protein [Ricinus communis] Length = 602 Score = 73.2 bits (178), Expect = 3e-11 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 3/67 (4%) Frame = -1 Query: 346 IGHDGRYFVCELC-NDGELIRCETCPRIYHIECLD--LKSVPTKEWQCPKCCSNEELSEP 176 IG DG Y+ C +C N G+L+ C+TCP YH++CL L+ VP+ WQC CC +L P Sbjct: 55 IGDDGHYYECVICDNGGDLLCCDTCPGTYHLQCLTPPLELVPSGNWQCENCCQAADLLTP 114 Query: 175 IKHLKNL 155 +K+L+ L Sbjct: 115 LKYLEGL 121 >ref|XP_002523656.1| chromodomain helicase DNA binding protein, putative [Ricinus communis] gi|223537108|gb|EEF38742.1| chromodomain helicase DNA binding protein, putative [Ricinus communis] Length = 2257 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 3/71 (4%) Frame = -1 Query: 355 SHEIGHDGRYFVCELCN-DGELIRCETCPRIYHIECLD--LKSVPTKEWQCPKCCSNEEL 185 S + G+DG Y+ C +C+ G L+ C++CPR+YH++CLD LK +P +WQCPKC + Sbjct: 66 SKKKGNDGYYYECVICDLGGNLLCCDSCPRVYHLQCLDPPLKRIPMGKWQCPKC---YQK 122 Query: 184 SEPIKHLKNLD 152 S+P+K + LD Sbjct: 123 SDPLKSITQLD 133