BLASTX nr result
ID: Glycyrrhiza23_contig00015432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015432 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520888.1| PREDICTED: endoribonuclease Dicer homolog 1-... 97 2e-18 ref|XP_004155270.1| PREDICTED: LOW QUALITY PROTEIN: endoribonucl... 96 4e-18 ref|XP_004134274.1| PREDICTED: endoribonuclease Dicer homolog 1-... 96 4e-18 ref|XP_003553805.1| PREDICTED: endoribonuclease Dicer homolog 1-... 96 4e-18 ref|XP_002515097.1| dicer-1, putative [Ricinus communis] gi|2235... 94 9e-18 >ref|XP_003520888.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Glycine max] Length = 1944 Score = 96.7 bits (239), Expect = 2e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +1 Query: 1 RFTFAVRVNTTDRGWTDECIGEPMPSVKKAKDSAAVLLLELINKLYS 141 RFTFAVRVNTTDRGWTDEC+GEPMPSVKKAKDSAAVLLLEL+NKLYS Sbjct: 1898 RFTFAVRVNTTDRGWTDECVGEPMPSVKKAKDSAAVLLLELLNKLYS 1944 >ref|XP_004155270.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 1-like [Cucumis sativus] Length = 1987 Score = 95.5 bits (236), Expect = 4e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +1 Query: 1 RFTFAVRVNTTDRGWTDECIGEPMPSVKKAKDSAAVLLLELINKLYS 141 RFTFAVRVNTTD+GWTDEC+GEPMPSVKKAKDSAAVLLLEL+NKLYS Sbjct: 1941 RFTFAVRVNTTDKGWTDECVGEPMPSVKKAKDSAAVLLLELLNKLYS 1987 >ref|XP_004134274.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Cucumis sativus] Length = 1986 Score = 95.5 bits (236), Expect = 4e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +1 Query: 1 RFTFAVRVNTTDRGWTDECIGEPMPSVKKAKDSAAVLLLELINKLYS 141 RFTFAVRVNTTD+GWTDEC+GEPMPSVKKAKDSAAVLLLEL+NKLYS Sbjct: 1940 RFTFAVRVNTTDKGWTDECVGEPMPSVKKAKDSAAVLLLELLNKLYS 1986 >ref|XP_003553805.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Glycine max] Length = 1942 Score = 95.5 bits (236), Expect = 4e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +1 Query: 1 RFTFAVRVNTTDRGWTDECIGEPMPSVKKAKDSAAVLLLELINKLYS 141 RFTFAVRVNTTD+GWTDEC+GEPMPSVKKAKDSAAVLLLEL+NKLYS Sbjct: 1896 RFTFAVRVNTTDKGWTDECVGEPMPSVKKAKDSAAVLLLELLNKLYS 1942 >ref|XP_002515097.1| dicer-1, putative [Ricinus communis] gi|223545577|gb|EEF47081.1| dicer-1, putative [Ricinus communis] Length = 1543 Score = 94.4 bits (233), Expect = 9e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +1 Query: 1 RFTFAVRVNTTDRGWTDECIGEPMPSVKKAKDSAAVLLLELINKLYS 141 RFTFAVRVNTTDRGWTDEC+GEPMPSVKKAKDSAAVLLLEL+NK YS Sbjct: 1497 RFTFAVRVNTTDRGWTDECVGEPMPSVKKAKDSAAVLLLELLNKRYS 1543