BLASTX nr result
ID: Glycyrrhiza23_contig00015360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015360 (413 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630770.1| Protein kinase [Medicago truncatula] gi|3555... 59 3e-07 >ref|XP_003630770.1| Protein kinase [Medicago truncatula] gi|355524792|gb|AET05246.1| Protein kinase [Medicago truncatula] Length = 479 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +1 Query: 166 DSDAVLILEYLAADLATVIANAAKDGLPLTVGEMKR*YPDSLC 294 D DAVL+LEYL DLATVI+NAAK+G+P+ VGE+KR LC Sbjct: 86 DEDAVLVLEYLTTDLATVISNAAKEGIPIPVGELKRWMIQILC 128