BLASTX nr result
ID: Glycyrrhiza23_contig00015343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015343 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532733.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-... 74 1e-11 ref|XP_003524916.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-... 74 1e-11 ref|XP_003524915.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-... 74 1e-11 ref|XP_002321107.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_004160641.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 57 2e-06 >ref|XP_003532733.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] Length = 570 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 316 EYNKNDAQFYGSIFAKMNKVEQARTAAAEQEPVPMTVDSQA 194 EYNK DAQFY SIFAKMNK+EQARTA A+QEPVPMT+DS+A Sbjct: 530 EYNKKDAQFYSSIFAKMNKLEQARTATAKQEPVPMTIDSEA 570 >ref|XP_003524916.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform 2 [Glycine max] Length = 521 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -2 Query: 316 EYNKNDAQFYGSIFAKMNKVEQARTAAAEQEPVPMTVDSQA 194 E+NK DAQFYGSIFAKMNK+EQARTA A+QEPVPMT+DS+A Sbjct: 481 EHNKKDAQFYGSIFAKMNKLEQARTATAKQEPVPMTIDSKA 521 >ref|XP_003524915.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform 1 [Glycine max] Length = 570 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -2 Query: 316 EYNKNDAQFYGSIFAKMNKVEQARTAAAEQEPVPMTVDSQA 194 E+NK DAQFYGSIFAKMNK+EQARTA A+QEPVPMT+DS+A Sbjct: 530 EHNKKDAQFYGSIFAKMNKLEQARTATAKQEPVPMTIDSKA 570 >ref|XP_002321107.1| predicted protein [Populus trichocarpa] gi|222861880|gb|EEE99422.1| predicted protein [Populus trichocarpa] Length = 577 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -2 Query: 316 EYNKNDAQFYGSIFAKMNKVEQAR-TAAAEQEPVPMTVDSQA 194 EYNK +AQFY +IFAKMNK+EQ T AA+Q+ +PMT+DS+A Sbjct: 536 EYNKKEAQFYSNIFAKMNKLEQTNSTMAAKQDAMPMTIDSKA 577 >ref|XP_004160641.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Cucumis sativus] Length = 571 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -2 Query: 316 EYNKNDAQFYGSIFAKMNKVEQARTAAAEQEPVPMTVDSQA 194 EYNK DAQFYG+IFAKMNK+E + +QE VPMT+DS+A Sbjct: 533 EYNKRDAQFYGNIFAKMNKLE--HNSGGKQEAVPMTIDSKA 571