BLASTX nr result
ID: Glycyrrhiza23_contig00015060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015060 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537777.1| PREDICTED: uncharacterized protein LOC100786... 69 5e-10 ref|XP_003540672.1| PREDICTED: uncharacterized protein LOC100779... 67 2e-09 gb|AAA74208.1| protein localized in the nucleoli of pea nuclei; ... 64 1e-08 ref|XP_002527136.1| nucleic acid binding protein, putative [Rici... 60 1e-07 ref|XP_003607240.1| RNA-binding protein [Medicago truncatula] gi... 60 2e-07 >ref|XP_003537777.1| PREDICTED: uncharacterized protein LOC100786132 [Glycine max] Length = 748 Score = 68.6 bits (166), Expect = 5e-10 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +1 Query: 214 MGKSSKKSATKVDAAPAVVTPSKSAKK-GKRQSDAEIEKQASAKK 345 MGKSSKKSA KVDAAPAVV PSKSAKK GKRQ+ EIEKQ SAKK Sbjct: 1 MGKSSKKSAIKVDAAPAVVPPSKSAKKGGKRQAQDEIEKQVSAKK 45 >ref|XP_003540672.1| PREDICTED: uncharacterized protein LOC100779929 [Glycine max] Length = 744 Score = 66.6 bits (161), Expect = 2e-09 Identities = 37/45 (82%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = +1 Query: 214 MGKSSKKSATKVDAAPAVVTPSKSAKK-GKRQSDAEIEKQASAKK 345 MGKSSKKSA KVDA PAVV PSKSAKK GKRQ+ EIEKQ SAKK Sbjct: 1 MGKSSKKSALKVDAVPAVVPPSKSAKKGGKRQAQDEIEKQLSAKK 45 >gb|AAA74208.1| protein localized in the nucleoli of pea nuclei; ORF; putative [Pisum sativum] Length = 611 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +1 Query: 214 MGKSSKKSATKVDAAPAVVTPSKSAKKGKRQSDAEIEKQASAKK 345 MGKSSKKSATKVDAAP VV+P KS KKGKRQ++ EI K+ SAKK Sbjct: 1 MGKSSKKSATKVDAAPVVVSPVKSGKKGKRQAEEEI-KKVSAKK 43 >ref|XP_002527136.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533496|gb|EEF35238.1| nucleic acid binding protein, putative [Ricinus communis] Length = 642 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 214 MGKSSKKSATKVDAAPAVVTPSKSAKKGKRQSDAEIEKQASAKK 345 MGKSSKKS KVDAAPAV SKS KKGKR+++ IEK SAKK Sbjct: 1 MGKSSKKSTPKVDAAPAVTPASKSTKKGKREAEEAIEKLVSAKK 44 >ref|XP_003607240.1| RNA-binding protein [Medicago truncatula] gi|355508295|gb|AES89437.1| RNA-binding protein [Medicago truncatula] Length = 623 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +1 Query: 214 MGKSSKKSATKVDAAPAVVTPSKSAKKGKRQSDAEIEKQASAKK 345 M KSSKKSATKVDAAP VV+P KS KKGKRQ++ E+ K SAKK Sbjct: 1 MPKSSKKSATKVDAAPVVVSPVKSGKKGKRQAEEEV-KAVSAKK 43