BLASTX nr result
ID: Glycyrrhiza23_contig00015011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00015011 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540680.1| PREDICTED: SWI/SNF complex subunit SWI3D-lik... 57 3e-07 >ref|XP_003540680.1| PREDICTED: SWI/SNF complex subunit SWI3D-like [Glycine max] Length = 1016 Score = 57.4 bits (137), Expect(2) = 3e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 171 WEALEASIEAQFEVIRSRGSDAHVVPTHCG 260 WE LEA+IEA+FE IRSRG++AHVVPTHCG Sbjct: 118 WETLEAAIEAEFEAIRSRGANAHVVPTHCG 147 Score = 21.6 bits (44), Expect(2) = 3e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 142 RQTPTNLSAS 171 RQTP NLSAS Sbjct: 72 RQTPNNLSAS 81