BLASTX nr result
ID: Glycyrrhiza23_contig00014730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00014730 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringsp... 111 5e-23 ref|NP_620833.1| 36 kDa protein [Strawberry latent ringspot viru... 70 2e-11 >gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringspot virus satellite RNA] Length = 287 Score = 111 bits (278), Expect = 5e-23 Identities = 53/95 (55%), Positives = 66/95 (69%) Frame = +2 Query: 2 PFASPLPRGPVPARRVVHVEPFTWDNMSYGQCSRTLALYKQLTSCFGSKMFQATLYKEAV 181 PFASP P P +V HV+P +W+ MS+GQCSR L LYKQL SCFG KMF ++LY AV Sbjct: 193 PFASPSPVRPALTPKVAHVDPVSWEGMSFGQCSRALTLYKQLCSCFGVKMFSSSLYGMAV 252 Query: 182 KKVCKLTDAVPVSIPEFMGRLGQVDFGAAPAHVYV 286 +KV +L + PV+IPE RLGQVD A H++V Sbjct: 253 RKVLRLREDFPVAIPENFARLGQVDRDARAVHLFV 287 >ref|NP_620833.1| 36 kDa protein [Strawberry latent ringspot virus satellite RNA] gi|478364|pir||JQ2018 hypothetical 36.5K protein - strawberry latent ringspot virus gi|312511|emb|CAA49480.1| 36 kDa protein [Strawberry latent ringspot virus satellite RNA] Length = 331 Score = 70.1 bits (170), Expect(2) = 2e-11 Identities = 33/73 (45%), Positives = 45/73 (61%), Gaps = 10/73 (13%) Frame = +2 Query: 11 SPLPRGPVPARRV----------VHVEPFTWDNMSYGQCSRTLALYKQLTSCFGSKMFQA 160 S LP GP+P+ + HV+P +W+ MS+GQCSR L LY+QL CFG KMF + Sbjct: 185 SGLPEGPIPSLLLRQSACNCPKGCHVDPVSWEGMSFGQCSRALTLYRQLCGCFGMKMFSS 244 Query: 161 TLYKEAVKKVCKL 199 +LY AV++ L Sbjct: 245 SLYGMAVRRFSAL 257 Score = 23.1 bits (48), Expect(2) = 2e-11 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +3 Query: 276 TSTYSFCYFSSWVCAFL-GTWALFKELKVV 362 TS YS+ S +V GTWA FK+ ++ Sbjct: 283 TSLYSYTSSSRFVPMIRSGTWAFFKDSLII 312