BLASTX nr result
ID: Glycyrrhiza23_contig00014552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00014552 (1052 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 87 7e-17 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 89 2e-15 ref|XP_003621698.1| hypothetical protein MTR_7g021810 [Medicago ... 64 6e-08 ref|XP_003636331.1| hypothetical protein MTR_037s0018 [Medicago ... 53 4e-07 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 87.4 bits (215), Expect(2) = 7e-17 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -1 Query: 716 MAKLVDATDLIGLSLGMETYQVKTFKFRETQEFIMGNPEPNPAFRKQ 576 MA+LVDATDLIGLSLGMETYQVKTFKFRET E MGNPEPNP+FRKQ Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQ 47 Score = 26.9 bits (58), Expect(2) = 7e-17 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 546 RIGAETQWKMF 514 RIGAETQWK+F Sbjct: 59 RIGAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 89.0 bits (219), Expect = 2e-15 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -1 Query: 716 MAKLVDATDLIGLSLGMETYQVKTFKFRETQEFIMGNPEPNPAFRKQ 576 MAKLVDATDLIGLSLGMETYQVKTFKFRET E MGNPEPNP+FRKQ Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQ 47 >ref|XP_003621698.1| hypothetical protein MTR_7g021810 [Medicago truncatula] gi|355496713|gb|AES77916.1| hypothetical protein MTR_7g021810 [Medicago truncatula] Length = 58 Score = 63.9 bits (154), Expect = 6e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 209 MKFLVRGKSVDFRNREGSSPSIPKSPFNSLI 117 MKFLVRGKSVDFRNREGSSPSIPKSPFNS++ Sbjct: 1 MKFLVRGKSVDFRNREGSSPSIPKSPFNSMV 31 >ref|XP_003636331.1| hypothetical protein MTR_037s0018 [Medicago truncatula] gi|355502266|gb|AES83469.1| hypothetical protein MTR_037s0018 [Medicago truncatula] Length = 717 Score = 53.1 bits (126), Expect(2) = 4e-07 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 942 IYLCILNCEYRDNRIISDSTKSGYLI 865 IYLCILNCEY DNRIISDSTK GYLI Sbjct: 26 IYLCILNCEYTDNRIISDSTKYGYLI 51 Score = 27.7 bits (60), Expect(2) = 4e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 874 VSDIDERKSIKQI 836 +SDIDERKSIKQI Sbjct: 51 ISDIDERKSIKQI 63