BLASTX nr result
ID: Glycyrrhiza23_contig00014519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00014519 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549894.1| PREDICTED: putative DNA-binding protein ESCA... 58 9e-07 ref|XP_003525782.1| PREDICTED: putative DNA-binding protein ESCA... 58 9e-07 >ref|XP_003549894.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine max] Length = 287 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 58 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 150 A LFHG+ PNLLNS+QMPSEPFWA + RPP+ Sbjct: 257 APLFHGLPPNLLNSVQMPSEPFWAASTRPPF 287 >ref|XP_003525782.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine max] Length = 283 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 58 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 150 A LFHG+ PNLLNS+QMPSEPFWA + RPP+ Sbjct: 253 APLFHGLPPNLLNSVQMPSEPFWAASARPPF 283