BLASTX nr result
ID: Glycyrrhiza23_contig00014236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00014236 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607766.1| hypothetical protein MTR_4g082510 [Medicago ... 79 4e-13 ref|XP_003517818.1| PREDICTED: uncharacterized protein LOC100799... 75 7e-12 ref|XP_003520100.1| PREDICTED: uncharacterized protein LOC100801... 74 2e-11 ref|XP_003613987.1| hypothetical protein MTR_5g043430 [Medicago ... 70 1e-10 emb|CAN65039.1| hypothetical protein VITISV_009459 [Vitis vinifera] 62 4e-08 >ref|XP_003607766.1| hypothetical protein MTR_4g082510 [Medicago truncatula] gi|355508821|gb|AES89963.1| hypothetical protein MTR_4g082510 [Medicago truncatula] Length = 1053 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 125 RMWWA*GMGTKVQSLPGYYSMRDLNEESSSCGWPLFYGDKA 3 R++W MGTKVQSLPGYYSMRDLNEESSSCGWPLFYGDKA Sbjct: 13 RLFW---MGTKVQSLPGYYSMRDLNEESSSCGWPLFYGDKA 50 >ref|XP_003517818.1| PREDICTED: uncharacterized protein LOC100799644 [Glycine max] Length = 1051 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 104 MGTKVQSLPGYYSMRDLNEESSSCGWPLFYGDKA 3 MGTKVQ+LPGYYSMRDLNEESSSCGWPLFYGDK+ Sbjct: 1 MGTKVQNLPGYYSMRDLNEESSSCGWPLFYGDKS 34 >ref|XP_003520100.1| PREDICTED: uncharacterized protein LOC100801474 [Glycine max] Length = 1115 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -2 Query: 107 GMGTKVQSLPGYYSMRDLNEESSSCGWPLFYGDKA 3 GMGTKVQ+LPGY SMRDLNEESSSCGWPLFYGDK+ Sbjct: 34 GMGTKVQNLPGYNSMRDLNEESSSCGWPLFYGDKS 68 >ref|XP_003613987.1| hypothetical protein MTR_5g043430 [Medicago truncatula] gi|355515322|gb|AES96945.1| hypothetical protein MTR_5g043430 [Medicago truncatula] Length = 1083 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -2 Query: 104 MGTKVQSLPGYYSM-RDLNEESSSCGWPLFYGDK 6 MGTK+QSLPGYYSM RDLNEESSSCGWPLFYGDK Sbjct: 41 MGTKIQSLPGYYSMMRDLNEESSSCGWPLFYGDK 74 >emb|CAN65039.1| hypothetical protein VITISV_009459 [Vitis vinifera] Length = 1250 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 3/37 (8%) Frame = -2 Query: 107 GMGTKVQS---LPGYYSMRDLNEESSSCGWPLFYGDK 6 GMGTKVQ LPGYYSMRDLNE+S+S GWPL+YGDK Sbjct: 102 GMGTKVQCKSYLPGYYSMRDLNEDSNSGGWPLYYGDK 138