BLASTX nr result
ID: Glycyrrhiza23_contig00013953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00013953 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543988.1| PREDICTED: metal-nicotianamine transporter Y... 102 4e-20 ref|XP_003556858.1| PREDICTED: metal-nicotianamine transporter Y... 101 6e-20 gb|AAS00691.1| metal-nicotianamine transporter YSL1 [Arabidopsis... 94 1e-17 gb|AAB63613.1| unknown protein [Arabidopsis thaliana] 94 1e-17 ref|NP_567694.2| metal-nicotianamine transporter YSL1 [Arabidops... 94 1e-17 >ref|XP_003543988.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Glycine max] Length = 668 Score = 102 bits (253), Expect = 4e-20 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +3 Query: 3 VVYVWDKVNPKKAEAMVPATASGLICGEGMWTLPASILALAKVKPPICMNFLAS 164 VVYVW K+N KKAEAM+PATASGLICGEG+W LPASILAL+K+KPPICMNFLAS Sbjct: 615 VVYVWHKLNSKKAEAMIPATASGLICGEGLWALPASILALSKIKPPICMNFLAS 668 >ref|XP_003556858.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Glycine max] Length = 670 Score = 101 bits (252), Expect = 6e-20 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +3 Query: 3 VVYVWDKVNPKKAEAMVPATASGLICGEGMWTLPASILALAKVKPPICMNFLAS 164 VVYVW K+N KKAEAM+PATASGLICGEG+W LPASILALAKV PPICMNFLAS Sbjct: 617 VVYVWHKLNTKKAEAMIPATASGLICGEGLWALPASILALAKVNPPICMNFLAS 670 >gb|AAS00691.1| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana] Length = 673 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = +3 Query: 3 VVYVWDKVNPKKAEAMVPATASGLICGEGMWTLPASILALAKVKPPICMNFLAS 164 +V+VW+K+N KKAE MVPA ASGLICGEG+WTLPA++LALA VKPPICM FLAS Sbjct: 620 IVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKFLAS 673 >gb|AAB63613.1| unknown protein [Arabidopsis thaliana] Length = 667 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = +3 Query: 3 VVYVWDKVNPKKAEAMVPATASGLICGEGMWTLPASILALAKVKPPICMNFLAS 164 +V+VW+K+N KKAE MVPA ASGLICGEG+WTLPA++LALA VKPPICM FLAS Sbjct: 614 IVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKFLAS 667 >ref|NP_567694.2| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana] gi|160359043|sp|Q6R3L0.2|YSL1_ARATH RecName: Full=Metal-nicotianamine transporter YSL1; AltName: Full=Protein YELLOW STRIPE LIKE 1; Short=AtYSL1 gi|332659452|gb|AEE84852.1| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana] Length = 673 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = +3 Query: 3 VVYVWDKVNPKKAEAMVPATASGLICGEGMWTLPASILALAKVKPPICMNFLAS 164 +V+VW+K+N KKAE MVPA ASGLICGEG+WTLPA++LALA VKPPICM FLAS Sbjct: 620 IVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKFLAS 673