BLASTX nr result
ID: Glycyrrhiza23_contig00013733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00013733 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531233.1| PREDICTED: reticuline oxidase-like protein-l... 57 1e-06 >ref|XP_003531233.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max] Length = 535 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +2 Query: 116 MSAIAFVASLVVPIFVLHILMSMSASNPLPGDTLLQCLSLNSEPSSP-PISELTYFPNNP 292 MSAIA + F+LH+LM+ S S P D++LQCLSL S+PS P PIS +TYFPN+P Sbjct: 1 MSAIAILP------FLLHVLMAASESEPFQ-DSILQCLSLYSDPSLPNPISAVTYFPNSP 53