BLASTX nr result
ID: Glycyrrhiza23_contig00013530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00013530 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548551.1| PREDICTED: pentatricopeptide repeat-containi... 82 4e-14 >ref|XP_003548551.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46610-like [Glycine max] Length = 808 Score = 82.4 bits (202), Expect = 4e-14 Identities = 59/115 (51%), Positives = 68/115 (59%), Gaps = 6/115 (5%) Frame = +1 Query: 19 LSTLPSRGG------FVLGSSCVVTDLNRKRRRMKLGFVYSISHSTSFGVFQCLTXXXXX 180 +ST PS+ F +G S V TD NR RRR+KLGF +S+SHS VFQ Sbjct: 2 ISTWPSKVNHLVVPRFEIGPSGV-TDQNR-RRRVKLGFAFSVSHSEKVSVFQ-------- 51 Query: 181 XXXXNSTVVFSGYPNPKFDLRCGFLLGYPGLKYDYTLLKPNKSHVGDLALPPLGW 345 TVVFSG+ K DLRCGFLLG K +LKP+KSHVGDLA PPLGW Sbjct: 52 FSRGYGTVVFSGH--AKLDLRCGFLLGCSRPKLG-IILKPHKSHVGDLA-PPLGW 102