BLASTX nr result
ID: Glycyrrhiza23_contig00013469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00013469 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626634.1| hypothetical protein MTR_8g005130 [Medicago ... 54 1e-05 >ref|XP_003626634.1| hypothetical protein MTR_8g005130 [Medicago truncatula] gi|355520656|gb|AET01110.1| hypothetical protein MTR_8g005130 [Medicago truncatula] Length = 88 Score = 54.3 bits (129), Expect = 1e-05 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = +3 Query: 3 MERRDKKLIDQASSN*LPGCFINGLVKGINCLSDALQLFQGSRGDHYN 146 MERRDKKL+DQ ++ VKGINCL DALQLF GSR D YN Sbjct: 49 MERRDKKLVDQV--------VLSACVKGINCLYDALQLFHGSRVDCYN 88