BLASTX nr result
ID: Glycyrrhiza23_contig00013203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00013203 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236473.1| MYB transcription factor MYB150 [Glycine max... 82 6e-14 ref|XP_003522999.1| PREDICTED: uncharacterized protein LOC100793... 79 4e-13 ref|XP_002514688.1| hypothetical protein RCOM_1470460 [Ricinus c... 55 6e-06 >ref|NP_001236473.1| MYB transcription factor MYB150 [Glycine max] gi|110931864|gb|ABH02931.1| MYB transcription factor MYB150 [Glycine max] Length = 210 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +2 Query: 2 VWDSGFVSCSKNKMDFLPTCSMIEEVFGDGRRQDMRRA 115 VWDSGFVSCSKNK+DFLPTC+MIEEVFGDGRRQDMRRA Sbjct: 173 VWDSGFVSCSKNKIDFLPTCNMIEEVFGDGRRQDMRRA 210 >ref|XP_003522999.1| PREDICTED: uncharacterized protein LOC100793553 [Glycine max] Length = 522 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +2 Query: 2 VWDSGFVSCSKNKMDFLPTCSMIEEVFGDGRRQDMRRA 115 VWDSGFVSCSKNK+DF+PTC+MIEEVFGDGRRQD+RRA Sbjct: 485 VWDSGFVSCSKNKIDFVPTCNMIEEVFGDGRRQDIRRA 522 >ref|XP_002514688.1| hypothetical protein RCOM_1470460 [Ricinus communis] gi|223546292|gb|EEF47794.1| hypothetical protein RCOM_1470460 [Ricinus communis] Length = 473 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +2 Query: 2 VWDSGFVSCSKNKMDFLPTCSMIEEVFGDG 91 +WD+G++ C K+K+D LPTCSMIEEVFGDG Sbjct: 421 IWDAGYMICPKSKVDLLPTCSMIEEVFGDG 450