BLASTX nr result
ID: Glycyrrhiza23_contig00013049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00013049 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624012.1| Disease resistance protein RGA2 [Medicago tr... 59 4e-07 ref|XP_003624016.1| Disease resistance protein RGA2 [Medicago tr... 55 5e-06 >ref|XP_003624012.1| Disease resistance protein RGA2 [Medicago truncatula] gi|124359570|gb|ABN05978.1| hypothetical protein MtrDRAFT_AC149204g17v2 [Medicago truncatula] gi|124360482|gb|ABN08492.1| hypothetical protein MtrDRAFT_AC157473g7v2 [Medicago truncatula] gi|355499027|gb|AES80230.1| Disease resistance protein RGA2 [Medicago truncatula] Length = 86 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +2 Query: 2 NLEYLKMEGCLELCRRYQRGVGQEWPKISHIKRVLI 109 NLE L MEGC ELCRRYQ VG +WPKISHIK V I Sbjct: 46 NLEILGMEGCPELCRRYQPEVGHDWPKISHIKHVYI 81 >ref|XP_003624016.1| Disease resistance protein RGA2 [Medicago truncatula] gi|124360485|gb|ABN08495.1| Disease resistance protein [Medicago truncatula] gi|355499031|gb|AES80234.1| Disease resistance protein RGA2 [Medicago truncatula] Length = 853 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 2 NLEYLKMEGCLELCRRYQRGVGQEWPKISHIKRVLI 109 NLE L+M+ C ELC+RYQ VG +WPKISHIKRV I Sbjct: 811 NLECLEMKDCPELCKRYQPKVGHDWPKISHIKRVNI 846