BLASTX nr result
ID: Glycyrrhiza23_contig00012936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00012936 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593669.1| NB-LRR type disease resistance protein Rps1-... 75 4e-12 ref|XP_003522054.1| PREDICTED: putative disease resistance prote... 73 3e-11 ref|XP_003521994.1| PREDICTED: putative disease resistance prote... 72 5e-11 ref|XP_003617828.1| NB-LRR type disease resistance protein Rps1-... 72 6e-11 ref|XP_003522023.1| PREDICTED: putative disease resistance prote... 71 8e-11 >ref|XP_003593669.1| NB-LRR type disease resistance protein Rps1-k-2 [Medicago truncatula] gi|355482717|gb|AES63920.1| NB-LRR type disease resistance protein Rps1-k-2 [Medicago truncatula] Length = 1250 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +3 Query: 3 RLPTSLMKLKIYKCPLLAERCRMKHPQIWPKISHIRGINVD 125 RLP SL++L+I +CPLL ERCRMKHPQIWPKISHIRGI VD Sbjct: 1206 RLPASLIELQIARCPLLEERCRMKHPQIWPKISHIRGIKVD 1246 >ref|XP_003522054.1| PREDICTED: putative disease resistance protein At3g14460-like [Glycine max] Length = 1232 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLPTSLMKLKIYKCPLLAERCRMKHPQIWPKISHIRGINVD 125 RLP SL+KL I++CPLL +RCRMKHPQIWPKISHI GI VD Sbjct: 1188 RLPDSLIKLTIWECPLLEKRCRMKHPQIWPKISHIPGIKVD 1228 >ref|XP_003521994.1| PREDICTED: putative disease resistance protein At3g14460-like [Glycine max] Length = 1242 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 3 RLPTSLMKLKIYKCPLLAERCRMKHPQIWPKISHIRGINVD 125 RLP SL+KL I +CPLL +RCRMKHPQIWPKISHI GI VD Sbjct: 1198 RLPVSLIKLTIERCPLLEKRCRMKHPQIWPKISHIPGIQVD 1238 >ref|XP_003617828.1| NB-LRR type disease resistance protein Rps1-k-2 [Medicago truncatula] gi|355519163|gb|AET00787.1| NB-LRR type disease resistance protein Rps1-k-2 [Medicago truncatula] Length = 1242 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLPTSLMKLKIYKCPLLAERCRMKHPQIWPKISHIRGINVD 125 RLP SL+KL+I +CPLL ERCRMKHPQIWPKIS IRGI VD Sbjct: 1198 RLPPSLIKLEIVECPLLEERCRMKHPQIWPKISLIRGIMVD 1238 >ref|XP_003522023.1| PREDICTED: putative disease resistance protein At3g14460-like [Glycine max] Length = 1322 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 RLPTSLMKLKIYKCPLLAERCRMKHPQIWPKISHIRGINVD 125 RLP SL+KL I +CPLL ++C KHPQIWPKISHIRGINVD Sbjct: 1198 RLPDSLIKLSIRRCPLLEKQCHRKHPQIWPKISHIRGINVD 1238