BLASTX nr result
ID: Glycyrrhiza23_contig00012715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00012715 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554977.1| PREDICTED: translation initiation factor eIF... 62 6e-08 ref|XP_003543906.1| PREDICTED: translation initiation factor eIF... 59 3e-07 >ref|XP_003554977.1| PREDICTED: translation initiation factor eIF-2B subunit delta-like [Glycine max] Length = 660 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 2/37 (5%) Frame = +1 Query: 220 MDAARRAPRAVIDP--KVRKVGFFAPPDRSQSGPTDP 324 MD +RRAPRAVIDP K+R+VGFFAPP+RSQSGP DP Sbjct: 1 MDPSRRAPRAVIDPIPKIRQVGFFAPPERSQSGPPDP 37 >ref|XP_003543906.1| PREDICTED: translation initiation factor eIF-2B subunit delta-like [Glycine max] Length = 659 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%), Gaps = 2/37 (5%) Frame = +1 Query: 220 MDAARRAPRAVIDP--KVRKVGFFAPPDRSQSGPTDP 324 MD +RRAPRAVIDP K+R+VGFFAPP+ SQSGP DP Sbjct: 1 MDPSRRAPRAVIDPVPKIRQVGFFAPPESSQSGPLDP 37