BLASTX nr result
ID: Glycyrrhiza23_contig00012633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00012633 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540600.1| PREDICTED: uncharacterized protein LOC100780... 62 2e-09 ref|XP_003538999.1| PREDICTED: uncharacterized protein LOC100786... 60 1e-08 ref|XP_003593340.1| hypothetical protein MTR_2g010410 [Medicago ... 62 3e-08 >ref|XP_003540600.1| PREDICTED: uncharacterized protein LOC100780115 [Glycine max] Length = 235 Score = 62.0 bits (149), Expect(2) = 2e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 171 KRKQLVQGMNFYLKVVTSIPGIDNHDANAVKSFI 70 +RKQLVQGMNFYLKVVTSIPGIDNHDANA+ I Sbjct: 158 ERKQLVQGMNFYLKVVTSIPGIDNHDANALSQAI 191 Score = 24.6 bits (52), Expect(2) = 2e-09 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 286 ERIGEKLKAEVNSLI 242 ERIGEKLKAE L+ Sbjct: 149 ERIGEKLKAERKQLV 163 >ref|XP_003538999.1| PREDICTED: uncharacterized protein LOC100786486 [Glycine max] Length = 235 Score = 59.7 bits (143), Expect(2) = 1e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 171 KRKQLVQGMNFYLKVVTSIPGIDNHDANAVKSFI 70 +RKQLVQGMNFYLKV+TSIPGIDNHDAN++ I Sbjct: 158 ERKQLVQGMNFYLKVLTSIPGIDNHDANSLSQAI 191 Score = 24.6 bits (52), Expect(2) = 1e-08 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 286 ERIGEKLKAEVNSLI 242 ERIGEKLKAE L+ Sbjct: 149 ERIGEKLKAERKQLV 163 >ref|XP_003593340.1| hypothetical protein MTR_2g010410 [Medicago truncatula] gi|355482388|gb|AES63591.1| hypothetical protein MTR_2g010410 [Medicago truncatula] Length = 326 Score = 61.6 bits (148), Expect(2) = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 168 RKQLVQGMNFYLKVVTSIPGIDNHDANAVKSFI 70 RKQLVQGMNFYLKVVTSIPGIDNHDANA+ I Sbjct: 250 RKQLVQGMNFYLKVVTSIPGIDNHDANALSQAI 282 Score = 21.2 bits (43), Expect(2) = 3e-08 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 286 ERIGEKLKAEVNSLILR 236 +RI EKLKAEV +++ Sbjct: 239 QRIEEKLKAEVRKQLVQ 255