BLASTX nr result
ID: Glycyrrhiza23_contig00012407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00012407 (654 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551899.1| PREDICTED: tryptophan synthase beta chain 2,... 75 8e-12 ref|XP_003519001.1| PREDICTED: tryptophan synthase beta chain 2,... 74 2e-11 ref|XP_003551820.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 dbj|BAD83779.1| tryptophan synthase beta subunit [Polygonum tinc... 72 9e-11 ref|XP_003599019.1| Pentatricopeptide repeat-containing protein ... 72 1e-10 >ref|XP_003551899.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Glycine max] Length = 471 Score = 75.5 bits (184), Expect = 8e-12 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = -2 Query: 143 TMMARILKDYVGRESTFYFVERWMEHYKKPNGEGTDIYMKREELNHT 3 T +A ILKDYVGRES YF ER EHYK+PNGEG IY+KRE+LNHT Sbjct: 116 TELAGILKDYVGRESPLYFAERLTEHYKRPNGEGPHIYLKREDLNHT 162 >ref|XP_003519001.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Glycine max] Length = 479 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -2 Query: 137 MARILKDYVGRESTFYFVERWMEHYKKPNGEGTDIYMKREELNHT 3 +A ILKDYVGRES YF ER EHYK+PNGEG IY+KRE+LNHT Sbjct: 126 LAGILKDYVGRESPLYFAERLTEHYKRPNGEGPHIYLKREDLNHT 170 >ref|XP_003551820.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39620-like [Glycine max] Length = 887 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -2 Query: 308 KDVASCKSIHSYGVRRYNCGVGPNSLPAMYSKCGEEYLAHRIFDRMLVYNVITWLTMMA 132 +DV SCKSIH Y VRR GV NSL MYSKCGE LAH+IFD+M V + I+W TMMA Sbjct: 243 EDVDSCKSIHGYVVRRCVFGVVSNSLIDMYSKCGEVKLAHQIFDQMWVKDDISWATMMA 301 >dbj|BAD83779.1| tryptophan synthase beta subunit [Polygonum tinctorium] Length = 474 Score = 72.0 bits (175), Expect = 9e-11 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 128 ILKDYVGRESTFYFVERWMEHYKKPNGEGTDIYMKREELNHT 3 ILKDYVGRE+ YF ER EHYK+PNGEG IY+KRE+LNHT Sbjct: 124 ILKDYVGRETPLYFAERLTEHYKRPNGEGPQIYLKREDLNHT 165 >ref|XP_003599019.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355488067|gb|AES69270.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 944 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/63 (55%), Positives = 43/63 (68%) Frame = -2 Query: 305 DVASCKSIHSYGVRRYNCGVGPNSLPAMYSKCGEEYLAHRIFDRMLVYNVITWLTMMARI 126 DV CKSIH Y VRR CGV NSL MY KCG+ + A R+FDRM V + ++W TMMA Sbjct: 215 DVGCCKSIHGYVVRRSICGVVSNSLIDMYCKCGDVHSAQRVFDRMGVRDDVSWATMMAGY 274 Query: 125 LKD 117 +K+ Sbjct: 275 VKN 277