BLASTX nr result
ID: Glycyrrhiza23_contig00012266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00012266 (716 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599025.1| Siroheme synthase [Medicago truncatula] gi|3... 66 8e-09 >ref|XP_003599025.1| Siroheme synthase [Medicago truncatula] gi|355488073|gb|AES69276.1| Siroheme synthase [Medicago truncatula] Length = 478 Score = 65.9 bits (159), Expect = 8e-09 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = +2 Query: 2 SILSAIFCCLSKSKVEDKKSPAVSVAVEAGSLSRKPKADPHPSSAPIVVSYFP 160 +ILSAIFCC KS+ EDK + V VEAGSLS+KPK +P SSAPIVVSYFP Sbjct: 2 TILSAIFCCF-KSEEEDKST---HVVVEAGSLSKKPKGEPQRSSAPIVVSYFP 50