BLASTX nr result
ID: Glycyrrhiza23_contig00012104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00012104 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517491.1| PREDICTED: calcium-dependent protein kinase ... 67 1e-09 ref|XP_003538257.1| PREDICTED: calcium-dependent protein kinase ... 66 3e-09 ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase ... 66 3e-09 ref|XP_003611046.1| Calcium dependent protein kinase [Medicago t... 65 6e-09 ref|XP_002509886.1| calcium-dependent protein kinase, putative [... 65 8e-09 >ref|XP_003517491.1| PREDICTED: calcium-dependent protein kinase 3-like [Glycine max] Length = 505 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 1 EVDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 99 EVDTDNDGRINYDEFV MMRKG PDLVTNRRRK Sbjct: 473 EVDTDNDGRINYDEFVAMMRKGKPDLVTNRRRK 505 >ref|XP_003538257.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 2 [Glycine max] Length = 516 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 1 EVDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 99 EVD DNDGRINYDEFV MMRKGNPDLV NRRRK Sbjct: 484 EVDADNDGRINYDEFVAMMRKGNPDLVNNRRRK 516 >ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 [Glycine max] Length = 505 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 1 EVDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 99 EVD DNDGRINYDEFV MMRKGNPDLV NRRRK Sbjct: 473 EVDADNDGRINYDEFVAMMRKGNPDLVNNRRRK 505 >ref|XP_003611046.1| Calcium dependent protein kinase [Medicago truncatula] gi|355512381|gb|AES94004.1| Calcium dependent protein kinase [Medicago truncatula] Length = 517 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 EVDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 99 EVD+DNDGRINY+EFV MMRKGNPDL+TN+RRK Sbjct: 485 EVDSDNDGRINYEEFVAMMRKGNPDLITNKRRK 517 >ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223549785|gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 528 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 EVDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 99 EVDTD+DGRINY+EFV MMRKGNP+LVTNRRRK Sbjct: 496 EVDTDHDGRINYEEFVAMMRKGNPELVTNRRRK 528