BLASTX nr result
ID: Glycyrrhiza23_contig00011926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00011926 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 68 7e-10 ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 ... 65 6e-09 ref|XP_002535070.1| conserved hypothetical protein [Ricinus comm... 63 2e-08 ref|XP_002536345.1| conserved hypothetical protein [Ricinus comm... 63 2e-08 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 91 REANCLPAGSCMSGNVHVRLREKGGGQKWP 2 REA+CLPAGSCMSGNVHVRLREKGGGQKWP Sbjct: 24 READCLPAGSCMSGNVHVRLREKGGGQKWP 53 >ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] gi|241947412|gb|EES20557.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] Length = 58 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 11 LSTALLTEPYVDVTAHTATSRQAVSLPLKRMEVWMNRHQIQV 136 +S LLTEPYVDVTAHTA S+QAVS PL+ MEVW+NRHQ V Sbjct: 6 ISVHLLTEPYVDVTAHTAPSQQAVSFPLEVMEVWINRHQTLV 47 >ref|XP_002535070.1| conserved hypothetical protein [Ricinus communis] gi|223524097|gb|EEF27311.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 91 REANCLPAGSCMSGNVHVRLREKGGGQKWP 2 R+ANCL AGSCMSGNVHVR REKGGGQKWP Sbjct: 63 RKANCLLAGSCMSGNVHVRFREKGGGQKWP 92 >ref|XP_002536345.1| conserved hypothetical protein [Ricinus communis] gi|223520024|gb|EEF26037.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 91 REANCLPAGSCMSGNVHVRLREKGGGQKWP 2 R+ANCL AGSCMSGNVHVR REKGGGQKWP Sbjct: 1 RKANCLLAGSCMSGNVHVRFREKGGGQKWP 30